Protein Info for SM_b21211 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 588 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 57 to 76 (20 residues), see Phobius details amino acids 86 to 108 (23 residues), see Phobius details amino acids 128 to 150 (23 residues), see Phobius details amino acids 162 to 188 (27 residues), see Phobius details PF08019: EptA_B_N" amino acids 67 to 213 (147 residues), 145.9 bits, see alignment E=9.1e-47 PF00884: Sulfatase" amino acids 246 to 534 (289 residues), 214.4 bits, see alignment E=2.4e-67

Best Hits

KEGG orthology group: K03760, phosphoethanolamine transferase (inferred from 100% identity to sme:SM_b21211)

Predicted SEED Role

"conserved putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92V40 at UniProt or InterPro

Protein Sequence (588 amino acids)

>SM_b21211 hypothetical protein (Sinorhizobium meliloti 1021)
MHARGASLEVSSLKIPRIPRPEIGSISLSAIVALYLLLATNNSFWAHASVYFVHARTSLL
AFAAALYLALFAILTPLSVKYLMKPALVILILVSATAAYFADTFGIIIDRDMIGNAAVTT
QAEASHLLTFSLARHLLVYAVLPSILIVWVRVRHRRFLPKAAVNFAFVSVSLLVGAGLIY
ANFATVAYALREHTDLMKRFNPSGPLIATVRYGLSTYRERNLVVRPLGTDAHQGARVAAA
GKPVVVVVVAGETARAMNFSLNGYERETNPELKALGVVNYRNTTSCGTATAVSLPCMFSV
YPRSQYSDWKARSTENLVNVLTHAGVSVSWWDNNTGSKGIADLISFASQTGRKNSPLCNN
GECLDEILLSDLDRKLGAAISNSVIVLHQLGSHGPSYYLRYPAAFRRFTPDCRTPELMRC
STAELVNAYDNTILYTDHILASVARLLEKHQDRIAGAMIYMSDHGESLGENGLYLHGAPY
VIAPKEQTQVPFIAWFSEPYQAAMGVDAGCLAKDADKPKSHDNLFHTVLGMMDVETRVYN
RDLDAFAACTRPANKEHQPAPGYHAAQNGEPESSAGGPQEARWAPGVL