Protein Info for SM_b21210 in Sinorhizobium meliloti 1021

Annotation: two-component response regulator protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 223 PF00072: Response_reg" amino acids 4 to 111 (108 residues), 88.1 bits, see alignment E=4.5e-29 PF00486: Trans_reg_C" amino acids 147 to 220 (74 residues), 53.6 bits, see alignment E=1.9e-18

Best Hits

Swiss-Prot: 39% identical to Y4XI_SINFN: Probable transcriptional regulatory protein y4xI (NGR_a00800) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: None (inferred from 100% identity to sme:SM_b21210)

Predicted SEED Role

"FIG01075101: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92V41 at UniProt or InterPro

Protein Sequence (223 amino acids)

>SM_b21210 two-component response regulator protein (Sinorhizobium meliloti 1021)
MRLLLVEDSPRLTELINETMHDAGWRLDGVSTLRDAEAAIAAREHDLVLLDLGLPDGDGL
QLLQWIRREHVGLPVLIITARGSVDERIAGLDAGADDYLVKPFHHRELLSRCRAMLRRNP
NAIQPVLEAGALRYDPATAELTCEGAVLPLPPRERSLIEILLREVGRVVPKRRLETALSE
YGQELSSNALELAVSRVRKRLQSVETGVQIETVRGIGYLLRTV