Protein Info for SM_b21208 in Sinorhizobium meliloti 1021

Annotation: TetR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 240 transmembrane" amino acids 188 to 206 (19 residues), see Phobius details PF00440: TetR_N" amino acids 29 to 74 (46 residues), 43.3 bits, see alignment 2.6e-15 PF09209: CecR_C" amino acids 113 to 232 (120 residues), 124.6 bits, see alignment E=2.4e-40

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SM_b21208)

Predicted SEED Role

"Transcriptional regulator YbiH, TetR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92V43 at UniProt or InterPro

Protein Sequence (240 amino acids)

>SM_b21208 TetR family transcriptional regulator (Sinorhizobium meliloti 1021)
MAHYRRMIKDGNRPAVLRADRGDATREKLLNTAIDVFGRYGFDGATTRKLADAAGVNLQA
IPYYFGGKEGLYVAAAEHLASIIGGHVGDLRTMIVSRLAELDAEGAAMTSMEARHFLTQM
VQRMIALFVSKESESWARFIIREQMEPTEAFKRIYGSIMGPMIEMARRLIGAILEDDPAS
EHIRLRTLSFVGSVLVFRMAHAAVYAQLEWESAGPKEIETLHRHAAELVAVLGAERDRRS