Protein Info for SM_b21207 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF25917: BSH_RND" amino acids 45 to 231 (187 residues), 36.1 bits, see alignment E=1.4e-12 PF25881: HH_YBHG" amino acids 77 to 202 (126 residues), 53.4 bits, see alignment E=9.6e-18 PF25876: HH_MFP_RND" amino acids 112 to 170 (59 residues), 24.9 bits, see alignment E=6e-09 PF25954: Beta-barrel_RND_2" amino acids 242 to 329 (88 residues), 41.1 bits, see alignment E=5.2e-14 PF25990: Beta-barrel_YknX" amino acids 245 to 326 (82 residues), 39.7 bits, see alignment E=1.5e-13

Best Hits

Swiss-Prot: 100% identical to Y5573_RHIME: UPF0194 membrane protein RB0873 (RB0873) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K01993, HlyD family secretion protein (inferred from 100% identity to smk:Sinme_4833)

Predicted SEED Role

"Predicted membrane fusion protein (MFP) component of efflux pump, membrane anchor protein YbhG"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92V44 at UniProt or InterPro

Protein Sequence (334 amino acids)

>SM_b21207 hypothetical protein (Sinorhizobium meliloti 1021)
MRKVAILVAIVAAGLAGAWWFDLPARLGFAREPRQAVLYGNVDIRQVSLGFRVSGRIAEL
RVDEGDSVKAGDVIAKLDAEPFRQAVGAAEAEAEVTRATLAKLRAGARAAEIAQARATHE
ERLAELENAKLAFERAKQLRPNGTISQAELDQANASRAAADARARSAREALVLLEEGNRA
EDIAAAAAQANAATAKADSARISLEDTQLAAPSDGVILSRVRETGAIVSPADIVYVLSLT
EPVWVRAYVAEPDLGRVHPGMKVTITSDTAPDRIYEGTVGFISPVAEFTPKSVETPELRT
DLVYRLRIVIANPGKDLRQGMPVTVHLPEAKEAS