Protein Info for SM_b21200 in Sinorhizobium meliloti 1021

Annotation: two-component response regulator protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 PF00072: Response_reg" amino acids 6 to 113 (108 residues), 101.5 bits, see alignment E=9.4e-33 PF00158: Sigma54_activat" amino acids 147 to 311 (165 residues), 208.5 bits, see alignment E=1.6e-65 PF14532: Sigma54_activ_2" amino acids 147 to 316 (170 residues), 60.3 bits, see alignment E=7.9e-20 PF07728: AAA_5" amino acids 169 to 288 (120 residues), 25.5 bits, see alignment E=3.5e-09 PF25601: AAA_lid_14" amino acids 318 to 374 (57 residues), 47.6 bits, see alignment 3.8e-16 PF02954: HTH_8" amino acids 396 to 436 (41 residues), 33.3 bits, see alignment 9.7e-12

Best Hits

Swiss-Prot: 56% identical to DCTD_PSEAE: C4-dicarboxylate transport transcriptional regulatory protein DctD (dctD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K10126, two-component system, NtrC family, C4-dicarboxylate transport response regulator DctD (inferred from 100% identity to smk:Sinme_4841)

Predicted SEED Role

"Two component, Sigma-54 Specific, central transcriptional regulator of acidic amino acid uptake"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92V52 at UniProt or InterPro

Protein Sequence (447 amino acids)

>SM_b21200 two-component response regulator protein (Sinorhizobium meliloti 1021)
MSESRILLVDDEEELRRSSAQALELAGFRVDTFASAEYALERIAFSFHGVVISDIRMPGM
DGMTFLQRIREIDAELPVILVTGHGDVQLAVRAMREGAYDFVEKPFTAQMLAGSIRRALD
WRSLVLENRRLRAVAGKRDDIEQRLPGRSQAMVDLRYRIRAIGASDADTLIIGETGVGKE
VVARALHDLSSRASGPFIAINCAALPENLIESELFGHEPGAFPGALRPRYGKFEHGRGGT
ILLDEIGSMPFDLQAKFLRVLQERVITRLGSNETVPLDVRFIATSKVDLEREVASSRFRA
DLLYRLNVATLRVPTLSQRRSDIPLLFMQLVRESAARYGRDDIVVSPALASEMAAREWPG
NVRELRNAAERLVLGLEVEREEALAPANGQRLTDKVAAFEKSVIASALAAHGGALKPVYE
SLGISRKTLYEKMQKFGLDKKALSEER