Protein Info for SM_b21198 in Sinorhizobium meliloti 1021

Annotation: oligopeptide uptake ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 transmembrane" amino acids 33 to 53 (21 residues), see Phobius details amino acids 176 to 198 (23 residues), see Phobius details amino acids 213 to 233 (21 residues), see Phobius details amino acids 238 to 257 (20 residues), see Phobius details amino acids 292 to 321 (30 residues), see Phobius details amino acids 342 to 364 (23 residues), see Phobius details PF12911: OppC_N" amino acids 18 to 65 (48 residues), 53 bits, see alignment 2.4e-18 PF00528: BPD_transp_1" amino acids 193 to 374 (182 residues), 106.8 bits, see alignment E=1.2e-34

Best Hits

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 100% identity to smk:Sinme_4843)

Predicted SEED Role

"Oligopeptide transport system permease protein OppC (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92V54 at UniProt or InterPro

Protein Sequence (376 amino acids)

>SM_b21198 oligopeptide uptake ABC transporter permease (Sinorhizobium meliloti 1021)
MTDIAQIPASTPETKGRSLFQLATLRFRRNRPAMAGCVMLVLIALFSFVGPLFSPHSYDQ
VFPSYVTIGPSLEPRPDTSTLQDVMEGVATRARVTLTEFNVDGETFTATVTSDKRIDPRA
TRYFDRANEFENSKVVATENDGRTLKVEGEVAREYFPFGTDSNGRDLLVRVMLGGQISIA
VGLLASLVSLGIGVVYGATSGYIGGRVDNVMMRLVEILYSLPFVFLVVVLVVFFGRSFIL
IFLVIGAVEWLDMARIVRGQTLALKRREFVGAAQALGLTDWQIIRRHIIPNTIGPVIVFV
TVVVPKVILLESFLSFLGLGVQAPLTSWGALISEGANNIQSAPWLLIFPAIFFVVTLFSL
NFVGDGLRDALDPKDR