Protein Info for SM_b21188 in Sinorhizobium meliloti 1021

Annotation: acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 transmembrane" amino acids 12 to 28 (17 residues), see Phobius details amino acids 36 to 54 (19 residues), see Phobius details amino acids 75 to 93 (19 residues), see Phobius details amino acids 121 to 145 (25 residues), see Phobius details amino acids 153 to 171 (19 residues), see Phobius details amino acids 183 to 200 (18 residues), see Phobius details amino acids 216 to 246 (31 residues), see Phobius details amino acids 248 to 274 (27 residues), see Phobius details amino acids 286 to 306 (21 residues), see Phobius details amino acids 318 to 336 (19 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 8 to 331 (324 residues), 101.1 bits, see alignment E=3.3e-33

Best Hits

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_4850)

Predicted SEED Role

"STRUCTURAL ELEMENTS; Cell Exterior; surface polysaccharides/antigens"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92V62 at UniProt or InterPro

Protein Sequence (377 amino acids)

>SM_b21188 acyltransferase (Sinorhizobium meliloti 1021)
MQMVRDQQLDGLRAVAVSMVLYAHFLAADGSHLGHLGVRLFFVLSGFLITRLLLDARDAA
RFEPATALKSFYARRALRIFPPYFAVLAAVFFLDLERSKEVMAWHALYLSNFWYALQNEW
TPWVLCHTWSLSIEEQFYLVWPLIVLLVPRRSVAGVCVGVIVCSLAYRFYWPLTGTPSLA
RDLLPPASMDALAVGALLAARPSWRSGWPAWAKLSWMPLSLASLCLVWSKPVAMTPVVAW
FAWIGLEVVPLLPLAMLVGGCSKGIGGLAGRLIALSPLAALGRISYGVYLFHAFVLALVV
QAQPFIPVNVSDQGAGRFVVAGALTLILASVSWLFFEKPLNGLKRHFPYVRPDGGAGAAA
AIPGASRDEALQPQNLR