Protein Info for SM_b21175 in Sinorhizobium meliloti 1021

Annotation: phosphate uptake ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 transmembrane" amino acids 30 to 50 (21 residues), see Phobius details amino acids 125 to 146 (22 residues), see Phobius details amino acids 166 to 184 (19 residues), see Phobius details amino acids 187 to 206 (20 residues), see Phobius details amino acids 231 to 249 (19 residues), see Phobius details amino acids 255 to 273 (19 residues), see Phobius details amino acids 285 to 306 (22 residues), see Phobius details TIGR01097: phosphonate ABC transporter, permease protein PhnE" amino acids 27 to 310 (284 residues), 255.6 bits, see alignment E=2.4e-80 PF00528: BPD_transp_1" amino acids 139 to 310 (172 residues), 65.5 bits, see alignment E=2.7e-22

Best Hits

KEGG orthology group: K02042, phosphonate transport system permease protein (inferred from 100% identity to sme:SM_b21175)

Predicted SEED Role

"Phosphonate ABC transporter permease protein phnE2 (TC 3.A.1.9.1)" in subsystem ABC transporter alkylphosphonate (TC 3.A.1.9.1) (TC 3.A.1.9.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7ANR2 at UniProt or InterPro

Protein Sequence (320 amino acids)

>SM_b21175 phosphate uptake ABC transporter permease (Sinorhizobium meliloti 1021)
MATSVSTRHLSENGALIERHWQELNNRRRLYTWLGLAFLALTLFSSLWFANESNAGKFFD
RLPHFFDFVGHLMPRDPIEIVRALFDLPSPYDDGSFKYNYPDGRLYVTESFYIPEYVHKM
LETVNIAIFSTIIGVFFGFILCFLAAKNLMPNPWIRGIVRRLMEILRAFPEVVIAGFFLA
ILSLGPIPAIAAVSIHTIGALGKLFFEVVENADMKPEEGLRAVGANWIERVWFGMVPQVL
PNFTSYFLLRLEINVRASTIIGAVGGGGIGELLRLSIGQGHEAKTLAIVLLLFATIFAVD
QFSAWLRRRLVGDQAFQLAQ