Protein Info for SM_b21174 in Sinorhizobium meliloti 1021

Annotation: phosphate uptake ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 505 transmembrane" amino acids 33 to 51 (19 residues), see Phobius details amino acids 313 to 335 (23 residues), see Phobius details amino acids 360 to 384 (25 residues), see Phobius details amino acids 422 to 440 (19 residues), see Phobius details amino acids 447 to 463 (17 residues), see Phobius details amino acids 475 to 496 (22 residues), see Phobius details TIGR01097: phosphonate ABC transporter, permease protein PhnE" amino acids 296 to 500 (205 residues), 245.6 bits, see alignment E=2.7e-77 PF00528: BPD_transp_1" amino acids 329 to 488 (160 residues), 52.5 bits, see alignment E=2.6e-18

Best Hits

KEGG orthology group: K02042, phosphonate transport system permease protein (inferred from 100% identity to sme:SM_b21174)

Predicted SEED Role

"Phosphonate ABC transporter permease protein phnE1 (TC 3.A.1.9.1)" in subsystem ABC transporter alkylphosphonate (TC 3.A.1.9.1) (TC 3.A.1.9.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7ANR3 at UniProt or InterPro

Protein Sequence (505 amino acids)

>SM_b21174 phosphate uptake ABC transporter permease (Sinorhizobium meliloti 1021)
MIASTNLDAREMEAIAARHPHLLQSSAAKRRSTALITAGVVLYMIFSWWFFSIGHVLANA
NWGIAGTYLADWVSYEVRPEIAVAPDGTMSVSFGRNSPLGDDPSPEWVTLEKETVTRTVA
APATAAQVQKPKTASSFSFMAPNAARGADTNSTPQEDAATTRTEEAVTHAVVNFDSSTRI
DVAEKLVTVTHSGETLVLQVDGADNVTPEGPLPSWAIQKRPGEKVTLSFGTTGWAEVEGD
EVSIRNRFFGWVNFLFDTNSPFFGKPYSEVASLIVSGERLDPARSNLSLAWNNILYNAEW
QHLDVWTKLLQTIVMAFVGTLFASFIAFPLCFLAARNITPSRLTNQFVKRFFDFLRSVDM
FIWALFFTRAFGPGPLAGISAIFFTDTGTLGKLYSEALENIDDKQREGVKSVGAAPVAVQ
RFGVLPQVLPVFASQALYFWESNTRSATIIGAVGAGGIGLKLWEAMRTNSDWENVAYMVL
LILMVVFVFDSISNLCRSRLIGRTH