Protein Info for SM_b21170 in Sinorhizobium meliloti 1021

Annotation: guanylate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02322: phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN
  • amino acids 9 to 186 (178 residues), 230.8 bits, E=4.6e-73
• PF00625: Guanylate_kin
  • amino acids 10 to 155 (146 residues), 25.7 bits, E=4.4e-10

Best Hits

Swiss-Prot: 51% identical to PHNN_AGRFC: Ribose 1,5-bisphosphate phosphokinase PhnN (phnN) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K05774, ribose 1,5-bisphosphokinase [EC: 2.7.4.23] (inferred from 100% identity to smk:Sinme_4867)

MetaCyc: 100% identical to ribose 1,5-bisphosphate phosphokinase (Sinorhizobium meliloti 1021)
Ribose 1,5-bisphosphate phosphokinase. [EC: 2.7.4.23]

Predicted SEED Role

"ATP-binding protein PhnN; Guanylate kinase (EC 2.7.4.8)" (EC 2.7.4.8)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• superpathway of purine nucleotide salvage (13/14 steps found)
• glyphosate degradation III (7/7 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (7/8 steps found)
• guanosine ribonucleotides de novo biosynthesis (4/4 steps found)
• dZTP biosynthesis (3/5 steps found)
• methylphosphonate degradation I (2/5 steps found)
• (aminomethyl)phosphonate degradation (4/8 steps found)

KEGG Metabolic Maps

• Pentose phosphate pathway
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.4.8

Use Curated BLAST to search for 2.7.4.23 or 2.7.4.8

Sequence Analysis Tools

See Q92V75 at UniProt or InterPro

Protein Sequence (195 amino acids)

>SM_b21170 guanylate kinase (Sinorhizobium meliloti 1021)
MTTADRVSGTLIVVVGPSGAGKDSVMGFAARHFAQRPDILFVRRAITRPSDAGGEVHESV
SDAEFEEMSRSGAFAVSWQAHGLSYAIPAEIAEKIAKGMTAIVNGSRAALPAIRQAFGTI
AVAVITAEPPVLAKRLAERGRESEEDVLRRLTRQAPDVIADADVTVIDNSGRLDMAGRQF
VALVERHSAKRHHPA