Protein Info for SM_b21167 in Sinorhizobium meliloti 1021

Annotation: reverse transcriptasematurase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 TIGR04416: group II intron reverse transcriptase/maturase" amino acids 53 to 397 (345 residues), 407.1 bits, see alignment E=3.3e-126 PF00078: RVT_1" amino acids 109 to 314 (206 residues), 130.2 bits, see alignment E=9e-42 PF08388: GIIM" amino acids 333 to 406 (74 residues), 67.2 bits, see alignment E=1e-22

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SM_b21167)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92V78 at UniProt or InterPro

Protein Sequence (453 amino acids)

>SM_b21167 reverse transcriptasematurase (Sinorhizobium meliloti 1021)
MQEARHQMPARAGRSGGRQGEALSEPGSDEATCPRCDAQSTGPGLLEAALARENLQRAWK
RVKANKGAAGADGLSIEATAAHLRTSWPDIRERVLAGTYRPMPVRRVTIPKPDGGERELG
IPTVTDRLIQQALLQVLQPLLDPAFSEHSHGFRPGRSAHDAVLEAQSYVQSGRRIVVDVD
LEKFFDRVNHDILIDRLSKRISDRRVIRLIRAYLNSGIMDHGVVQERVMGTPQGGPLSPL
LANVLLDEVDKELERRGHCFVRYADDCNVYVGSRKAGERVMALLRRLYGRLHLTINEGKS
AVTSVFGRKFLGFSFWRGRDGAVKRRVADKPLNAFKRRVRQLTRRSGGRSMAEVAERLRV
YVLGWKAYFRLAQTPRLFKELEEWMRHRVRAIQLKHWKRGKTTYKALLAKGAKPEAARQI
AVNSRRWWRNSGMLLNSVLTLRWMDALRIPRLA