Protein Info for SM_b21147 in Sinorhizobium meliloti 1021

Annotation: choline uptake ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 53 to 76 (24 residues), see Phobius details amino acids 94 to 113 (20 residues), see Phobius details amino acids 119 to 142 (24 residues), see Phobius details amino acids 166 to 190 (25 residues), see Phobius details amino acids 211 to 231 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 70 to 227 (158 residues), 68.7 bits, see alignment E=2.9e-23

Best Hits

Swiss-Prot: 44% identical to YEHW_ECOLI: Glycine betaine uptake system permease protein YehW (yehW) from Escherichia coli (strain K12)

KEGG orthology group: K05846, osmoprotectant transport system permease protein (inferred from 100% identity to smk:Sinme_4891)

MetaCyc: 44% identical to glycine betaine ABC transporter membrane subunit YehW (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-283

Predicted SEED Role

"L-proline glycine betaine ABC transport system permease protein ProW (TC 3.A.1.12.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92V96 at UniProt or InterPro

Protein Sequence (245 amino acids)

>SM_b21147 choline uptake ABC transporter permease (Sinorhizobium meliloti 1021)
MATLPNLFRLTVLAVLLAFLVQPAWFEPLLKPLVQENAPAVYNQGSLFWLTVLHLRTVFV
ATVAATIVAVSLAIIVTRKAGAEFLPLSRSLVNIGQTFPPVAVLALAVPIYGFGEKPTLI
ALFLYGLLPIFENALTGLTTLPPTVMEAARGAGMTGRQRLFRIELPLALPVILTGIRLSV
VISLATATIGSTVAARTLGEVIIAGLQSNNLAFVLQGGLIVGALAVLIHDALQGLERAFA
GRAHI