Protein Info for SM_b21145 in Sinorhizobium meliloti 1021

Annotation: choline uptake ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 59 to 77 (19 residues), see Phobius details amino acids 84 to 103 (20 residues), see Phobius details amino acids 116 to 136 (21 residues), see Phobius details amino acids 146 to 167 (22 residues), see Phobius details amino acids 191 to 212 (22 residues), see Phobius details amino acids 224 to 249 (26 residues), see Phobius details amino acids 265 to 289 (25 residues), see Phobius details amino acids 310 to 330 (21 residues), see Phobius details amino acids 336 to 356 (21 residues), see Phobius details amino acids 363 to 386 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 205 to 385 (181 residues), 71.1 bits, see alignment E=5.4e-24

Best Hits

KEGG orthology group: K05846, osmoprotectant transport system permease protein (inferred from 100% identity to sme:SM_b21145)

Predicted SEED Role

"L-proline glycine betaine ABC transport system permease protein ProW (TC 3.A.1.12.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92V98 at UniProt or InterPro

Protein Sequence (399 amino acids)

>SM_b21145 choline uptake ABC transporter permease (Sinorhizobium meliloti 1021)
MATGIIQTRERLAFRFDKLGLIIAILVLYGALLAPFATFRANRIIQGEARAILEALPPPL
GYGLLALVVAGAGVAFLRTPRLLRMAVALAALAALALLIGVAADHLTPPDNSFARVSPAS
GFWVLVFAFSLLLADALTRLNPGPGLRLLVFAGVLVLAGGMLVTGRWDDLSIVKEYANRA
DLFWTEAGRHVTLALGSLAAATIVGLPLGILCHRVERLRAGVLNVLNAIQTIPSIALFGI
LIAPLGWIAANVPGAAAIGIRGIGAAPAFVALFLYSLLPVVANTVVGLAGVPHAANDAAR
GIGMTDRQRLVAIEFPLAFPVILTGIRIVLVQNIGLATIAALIGGGGFGVFVFQGVGQTA
MDLVLLGAIPTVVLAFTAAIVLDALIEMTMPNRSRGNAA