Protein Info for SM_b21139 in Sinorhizobium meliloti 1021

Annotation: translation initiation inhibitors

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 127 PF01042: Ribonuc_L-PSP" amino acids 19 to 124 (106 residues), 90 bits, see alignment E=5.8e-30

Best Hits

Swiss-Prot: 46% identical to RIDA_PYRFU: 2-iminobutanoate/2-iminopropanoate deaminase (yjgF) from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)

KEGG orthology group: None (inferred from 98% identity to smk:Sinme_4982)

Predicted SEED Role

"Bona fide RidA/YjgF/TdcF/RutC subgroup"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92VI5 at UniProt or InterPro

Protein Sequence (127 amino acids)

>SM_b21139 translation initiation inhibitors (Sinorhizobium meliloti 1021)
MTIKRYGTGETGAGKQHLPFARAVEANGWLYVSGQVAMEAGEIVGGGIVAESRKAIENMI
AILHEAGYGLEDVVRVGVWLDDPRDFWTFNGVYAQYFGANPPARACVQSRMMVDCKVEVD
CVAYKAK