Protein Info for SM_b21131 in Sinorhizobium meliloti 1021

Annotation: sulfate ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 transmembrane" amino acids 27 to 51 (25 residues), see Phobius details amino acids 73 to 99 (27 residues), see Phobius details amino acids 110 to 133 (24 residues), see Phobius details amino acids 145 to 169 (25 residues), see Phobius details amino acids 210 to 234 (25 residues), see Phobius details amino acids 255 to 275 (21 residues), see Phobius details TIGR00969: sulfate ABC transporter, permease protein" amino acids 25 to 282 (258 residues), 323.6 bits, see alignment E=1.1e-100 TIGR02140: sulfate ABC transporter, permease protein CysW" amino acids 26 to 282 (257 residues), 408.8 bits, see alignment E=9.6e-127 PF00528: BPD_transp_1" amino acids 89 to 283 (195 residues), 47 bits, see alignment E=1.3e-16

Best Hits

Swiss-Prot: 54% identical to CYSW_SYNY3: Sulfate transport system permease protein CysW (cysW) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K02047, sulfate transport system permease protein (inferred from 100% identity to sme:SM_b21131)

MetaCyc: 52% identical to sulfate/thiosulfate ABC transporter inner membrane subunit CysW (Escherichia coli K-12 substr. MG1655)
ABC-19-RXN [EC: 7.3.2.5]; ABC-7-RXN [EC: 7.3.2.5, 7.3.2.3]; 7.3.2.3 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-478 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-479 [EC: 7.3.2.5, 7.3.2.3]

Predicted SEED Role

"Sulfate transport system permease protein CysW" in subsystem Cysteine Biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.3 or 7.3.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92VJ1 at UniProt or InterPro

Protein Sequence (293 amino acids)

>SM_b21131 sulfate ABC transporter permease (Sinorhizobium meliloti 1021)
MVMAHDAGYASNTLVTAATSETRLSRVVLTIVALGFVALFLLLPLATVFIEAFRKGAAEF
FTALGDPETFSAIRLTLLVAGIAVPLNLVFGVAAAWAIAKFEFKGKAFLTTLIDLPFSVS
PVISGLVFVLLFSSHSVLGPILQSYGIQILFAVPGLVLATVFVTFPFVARELIPLMQEQG
TADEEAALSLGATGWQTFWHVTLPNIKWGLLYGVLLCNARAMGEFGAVSVVSGHIRGQTN
TMPLQVEILYNEYNFVAAFAVAALLALLALVTLVLKTALELRYSDEIAASRRH