Protein Info for SM_b21121 in Sinorhizobium meliloti 1021

Updated annotation (from data): Isovaleryl-CoA dehydrogenase (EC 1.3.8.4)
Rationale: Specifically important for utilizing L-Leucine. Automated validation from mutant phenotype: the predicted function (RXN0-2301) was linked to the condition via a MetaCyc pathway. This annotation was also checked manually.
Original annotation: isovaleryl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 transmembrane" amino acids 251 to 269 (19 residues), see Phobius details PF02771: Acyl-CoA_dh_N" amino acids 12 to 123 (112 residues), 137.7 bits, see alignment E=4.4e-44 PF02770: Acyl-CoA_dh_M" amino acids 127 to 222 (96 residues), 92.9 bits, see alignment E=2.4e-30 PF00441: Acyl-CoA_dh_1" amino acids 234 to 382 (149 residues), 152.7 bits, see alignment E=1.6e-48 PF08028: Acyl-CoA_dh_2" amino acids 251 to 365 (115 residues), 57.8 bits, see alignment E=2.9e-19

Best Hits

Swiss-Prot: 66% identical to IVD_ORYSJ: Isovaleryl-CoA dehydrogenase, mitochondrial (Os05g0125500) from Oryza sativa subsp. japonica

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_5000)

MetaCyc: 75% identical to isovaleryl-CoA dehydrogenase subunit (Pseudomonas aeruginosa PAO1)
RXN0-2301 [EC: 1.3.8.4]

Predicted SEED Role

"Isovaleryl-CoA dehydrogenase (EC 1.3.8.4)" (EC 1.3.8.4)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.8.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92VK1 at UniProt or InterPro

Protein Sequence (387 amino acids)

>SM_b21121 Isovaleryl-CoA dehydrogenase (EC 1.3.8.4) (Sinorhizobium meliloti 1021)
MFEAGLNFALGEEIDALRASVRRFASERIAPLADDADRSNAFPMSLWREMGELGLLGITA
DEAHGGAGLGYLAHCVAMEEISRASASVGLSYGAHSNLCVNQINRNGKPAQKSRYLPKLI
SGEHVGALAMSEPGAGSDVVSMKLKADKRGDRYVLNGSKMWITNGPDADVLVVYAKTDPA
AGPRGITAFLVEKAFPGFSAGQKLDKLGMRGSNTSELIFTDCEVPEENVLGGVGEGVKVL
MSGLDYERVVLSAGPLGIMAACLDVVVPYLHERKQFGQPIGEFQLMQGKLADMYVTMNAA
RAYVYAVAAACDRGETARKDAAGCILYAAEKATAMALEAIQALGGNGYTNDYPAGRLLRD
AKLYEIGAGTSEIRRMLIGRELFAETK