Protein Info for SM_b21110 in Sinorhizobium meliloti 1021

Updated annotation (from data): dehydratase involved in L-fucose catabolism
Rationale: Specifically important in carbon source L-Fucose. This protein is similar to the (R)-enoyl-CoA hydratase portion of E. coli maoC (36% identical). It is one of three dehydratases involved in L-fucose catabolism (see SMc02776 and SM_b21107)
Original annotation: MaoC-like (monoamine oxidase-like) protein, NodN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 153 transmembrane" amino acids 61 to 83 (23 residues), see Phobius details PF01575: MaoC_dehydratas" amino acids 15 to 111 (97 residues), 74.8 bits, see alignment E=2.3e-25

Best Hits

KEGG orthology group: None (inferred from 99% identity to smk:Sinme_5009)

Predicted SEED Role

"Aldehyde dehydrogenase (EC 1.2.1.3)" in subsystem Entner-Doudoroff Pathway or Glycerolipid and Glycerophospholipid Metabolism in Bacteria or Methylglyoxal Metabolism or Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 1.2.1.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.3

Use Curated BLAST to search for 1.2.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92VL2 at UniProt or InterPro

Protein Sequence (153 amino acids)

>SM_b21110 dehydratase involved in L-fucose catabolism (Sinorhizobium meliloti 1021)
MSEQTIYYEDYEQGHVRLTSGRTITETDFVVHAGHTGDFFPHHMDAEFAKTLPGGQRIAH
GTMIFSIGVGLTASLINPVAFSYGYDRLRFVRPVHIGDTIRTRVTIAAKEDDPKRPGAGR
VVERCEVINQRGEVVLAADHILIVERKPEGTIQ