Protein Info for SM_b21105 in Sinorhizobium meliloti 1021

Updated annotation (from data): ABC transporter for L-Fucose, permease component 2
Rationale: Specific phenotypes on L-Fucose.
Original annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 transmembrane" amino acids 16 to 38 (23 residues), see Phobius details amino acids 86 to 107 (22 residues), see Phobius details amino acids 118 to 141 (24 residues), see Phobius details amino acids 151 to 172 (22 residues), see Phobius details amino acids 252 to 273 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 101 to 280 (180 residues), 79.4 bits, see alignment E=1.5e-26

Best Hits

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 100% identity to sme:SM_b21105)

MetaCyc: 33% identical to ABC-type sulfoquinovose transporter permease subunit (Clostridium sp. MSTE9)
7.5.2.-

Predicted SEED Role

"Maltose/maltodextrin ABC transporter, permease protein MalG" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92VL7 at UniProt or InterPro

Protein Sequence (288 amino acids)

>SM_b21105 ABC transporter for L-Fucose, permease component 2 (Sinorhizobium meliloti 1021)
MDTNASHRLRRRLLKVAHLAGLFLAMLVICLPGLWIVLSSLRPTVEIMAKPPVWIPETLS
LDAYRAMFSGAGQGGVPVWDYFRNSLIVSVTSTVIALAIGLSGGYAFARYRFKAKSAIFL
GFMLTRAVPGIALSLPLFMLYARTGIIDTHFSLILTYVALNVPFTIWLIDGFFRQVPKDL
AEAAQIDGCTPWQAFWQVEFPLAGPGIASAGIFAFLTSWNEYALASQITRSVNSKTLPVG
LLDYTAEFTIDWRGMCALAVVMIVPALTLTFIIQKHLVSGLTFGAVKG