Protein Info for SM_b21104 in Sinorhizobium meliloti 1021

Updated annotation (from data): ABC transporter for L-Fucose, permease component 1
Rationale: Specific phenotypes on L-Fucose.
Original annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 72 to 94 (23 residues), see Phobius details amino acids 106 to 126 (21 residues), see Phobius details amino acids 157 to 183 (27 residues), see Phobius details amino acids 205 to 223 (19 residues), see Phobius details amino acids 265 to 284 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 85 to 288 (204 residues), 57 bits, see alignment E=1.1e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SM_b21104)

Predicted SEED Role

"Maltose/maltodextrin ABC transporter, permease protein MalF" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92VL8 at UniProt or InterPro

Protein Sequence (298 amino acids)

>SM_b21104 ABC transporter for L-Fucose, permease component 1 (Sinorhizobium meliloti 1021)
MKLSKLSAPTLLLLPAFIVLAVFIVLPLIFSLYSSFTPFRLTKPDSLWVFIGFRNYVNVL
TNAEFWVAFGRTVLLLTVALNAEMFLGLGLALLVNKATYGQRALRTAMMFPMMFSPVLVG
FQFKFLFNDNIGFVNNALQSLGLTDRAIPWLIDGNLALFSIIVAEVWSSTAVFAILILAG
LLAMPKDPVEAAHVDGCTPWQTFRYVTWPYLMPFAFIAMTIRSLDVARAYDIVKIMTDGG
PAKRTELLWTLIGRTAYGDARMGMANAMAYVAILLSIFFTVYFFRKLAAARQQIGAEW