Protein Info for SM_b21081 in Sinorhizobium meliloti 1021

Annotation: phosphoglucomutase phosphomannomutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02878: PGM_PMM_I
  • amino acids 49 to 174 (126 residues), 77 bits, E=2.4e-25
• PF02879: PGM_PMM_II
  • amino acids 202 to 288 (87 residues), 87 bits, E=2.3e-28
• PF02880: PGM_PMM_III
  • amino acids 294 to 404 (111 residues), 61.1 bits, E=2.3e-20
• PF00408: PGM_PMM_IV
  • amino acids 444 to 499 (56 residues), 25 bits, 3.2e-09

Best Hits

KEGG orthology group: K01835, phosphoglucomutase [EC: 5.4.2.2] (inferred from 100% identity to sme:SM_b21081)

Predicted SEED Role

No annotation

MetaCyc Pathways

• O-antigen building blocks biosynthesis (E. coli) (10/11 steps found)
• dTDP-β-L-rhamnose biosynthesis (5/5 steps found)
• glycogen biosynthesis I (from ADP-D-Glucose) (4/4 steps found)
• UDP-α-D-glucose biosynthesis (2/2 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• glucose and glucose-1-phosphate degradation (4/5 steps found)
• sucrose degradation II (sucrose synthase) (4/5 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• glycogen degradation I (6/8 steps found)
• sucrose degradation IV (sucrose phosphorylase) (3/4 steps found)
• GDP-α-D-glucose biosynthesis (2/3 steps found)
• trehalose degradation V (2/3 steps found)
• glycogen degradation II (4/6 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• chitin biosynthesis (6/9 steps found)
• CDP-6-deoxy-D-gulose biosynthesis (3/5 steps found)
• D-galactose degradation I (Leloir pathway) (3/5 steps found)
• glucosylglycerol biosynthesis (3/5 steps found)
• sucrose biosynthesis II (5/8 steps found)
• starch degradation III (2/4 steps found)
• starch degradation V (2/4 steps found)
• starch biosynthesis (6/10 steps found)
• colanic acid building blocks biosynthesis (6/11 steps found)
• glycogen biosynthesis III (from α-maltose 1-phosphate) (3/8 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (5/19 steps found)
• streptomycin biosynthesis (3/18 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Glycolysis / Gluconeogenesis
• Nucleotide sugars metabolism
• Pentose phosphate pathway
• Starch and sucrose metabolism
• Streptomycin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 5.4.2.2

Use Curated BLAST to search for 5.4.2.2

Sequence Analysis Tools

See Q92VN9 at UniProt or InterPro

Protein Sequence (515 amino acids)

>SM_b21081 phosphoglucomutase phosphomannomutase (Sinorhizobium meliloti 1021)
MNFARFEPASANGPAQESGPEKFTYETSPLIRATGFREYDARWWFGRSDCGKAPELNLMG
AQALGMGLGTFIQRSGAGPEIVTGHDFRSYSLGIKLALVCGLMAAGARVRDIGLALSPMA
YFAQFALDVPSVAMVTASHNENGWTGVKMGMARPLTFGPQEMAELRRIVLEADFDLTGGG
AYEFVPDFRRRYIDDLTRGRRIGRKLKVVAACGNGTAGAFAPDVLQRIGCEVIPLDCDLD
HSFPRYNPNPEDLKMLHAIRDKVLESGADVGLGFDGDGDRCGVVDNEGSEIFADKIGVML
ARDISASNPGSVFVVDVKSTGLFASDPVLKANGARTDYWKTGHSYIKRRVAELGAIAGFE
KSGHFFFNAPLGRGYDDGLITAISICEMLDRSPNRSIAEIYRALPMTWSSPTMSPHCADE
VKYAVAERVVERFRAMQRDGVPVAGQMIADLVTVNGVRVVTEDGTWGLVRASSNKPELVV
VVESPVSEARQRAMFEAVDCVLRENPEVGAYNQTI