Protein Info for SM_b21052 in Sinorhizobium meliloti 1021

Annotation: epimerase dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF04321: RmlD_sub_bind" amino acids 5 to 263 (259 residues), 28.3 bits, see alignment E=3.3e-10 PF02719: Polysacc_synt_2" amino acids 6 to 263 (258 residues), 43.3 bits, see alignment E=9.9e-15 PF01370: Epimerase" amino acids 6 to 241 (236 residues), 188.1 bits, see alignment E=6.5e-59 PF01073: 3Beta_HSD" amino acids 7 to 226 (220 residues), 45.8 bits, see alignment E=1.5e-15 PF16363: GDP_Man_Dehyd" amino acids 7 to 262 (256 residues), 160 bits, see alignment E=3.8e-50 PF13460: NAD_binding_10" amino acids 10 to 175 (166 residues), 28 bits, see alignment E=6.9e-10 PF07993: NAD_binding_4" amino acids 74 to 178 (105 residues), 30.3 bits, see alignment E=8.6e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SM_b21052)

Predicted SEED Role

"dTDP-glucose 4,6-dehydratase (EC 4.2.1.46)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 4.2.1.46)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.46

Use Curated BLAST to search for 4.2.1.46

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92VR8 at UniProt or InterPro

Protein Sequence (321 amino acids)

>SM_b21052 epimerase dehydratase (Sinorhizobium meliloti 1021)
MMAQSILITGGAGNIGSALTRALVKLPQTQVVVADNLSTGSRDKVQIDAGNLTVIRSDAN
DFDDISSLFYRFHFTHVFHFAAVVGVQRTLANPLLVLRDIAGIENVLRLCKNTGAERVYF
ASSSEVYGEPFEIPQNENTTPLNSRLPYAVVKNLGEVYLRTYEREFGLPFTIFRFFNTYG
PRQSEDFVLPRFLRAALLGVPLTIYGDGSQTRTFCYVDDTVDTCIAVHRTRSHENDVINV
GSDLEVSIRQLAEIVIGVLGSSSKLEFLPPLTEGDMTRRCPDTSKMKALLNRPLVPLEEG
IRRLAEHLSKSQSSHELRKVA