Protein Info for SM_b21051 in Sinorhizobium meliloti 1021

Annotation: udpglucosegdpmannose dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details TIGR03026: nucleotide sugar dehydrogenase" amino acids 23 to 434 (412 residues), 425.9 bits, see alignment E=7.3e-132 PF03721: UDPG_MGDP_dh_N" amino acids 23 to 200 (178 residues), 140.6 bits, see alignment E=9.1e-45 PF03446: NAD_binding_2" amino acids 23 to 154 (132 residues), 28.8 bits, see alignment E=2.5e-10 PF00984: UDPG_MGDP_dh" amino acids 220 to 310 (91 residues), 110.3 bits, see alignment E=8e-36 PF03720: UDPG_MGDP_dh_C" amino acids 339 to 436 (98 residues), 79.4 bits, see alignment E=4.9e-26

Best Hits

Swiss-Prot: 55% identical to UGND_PSEAE: UDP-N-acetyl-D-glucosamine 6-dehydrogenase (wbpA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K13015, UDP-N-acetyl-D-glucosamine dehydrogenase [EC: 1.1.1.-] (inferred from 100% identity to sme:SM_b21051)

MetaCyc: 55% identical to UDP-N-acetyl-D-glucosamine 6-dehydrogenase monomer (Pseudomonas aeruginosa PAO1)
UDP-N-acetylglucosamine 6-dehydrogenase. [EC: 1.1.1.136]

Predicted SEED Role

"UDP-glucose dehydrogenase (EC 1.1.1.22)" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance ) or Teichuronic acid biosynthesis (EC 1.1.1.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-, 1.1.1.22

Use Curated BLAST to search for 1.1.1.- or 1.1.1.136 or 1.1.1.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92VR9 at UniProt or InterPro

Protein Sequence (449 amino acids)

>SM_b21051 udpglucosegdpmannose dehydrogenase (Sinorhizobium meliloti 1021)
MQHMNTGPDAEKLLNRIRTRDFTIGIMGLGYVGLPLAMSSLEAGFRVIGFDIDQSRVALL
NRGESGIKHLPGPAIQQAVESKRFRATSDFSELSMPDAILIAVPTPLTRNREPNLSFVEN
SARSIAERLRPGQLVVLESTTWPGTTREIVRPLLEATNLVVGKDFFLAYSPEREDPGNEV
HTTTSVPKVIGADEPSSLEVAQALYSQIIVRTVPVTSTATAEAVKLTENIFRSVNIALVN
ELKVIFDRMGIDVWEVIEAAKTKPFGYMAFYPGPGLGGHCIPIDPFYLTWKAREYEVATR
FIELAGEVNTNMPHYVVDRLVEALDRRARRGLNESRILLIGMAYKKNVGDTRESPSLRLI
DLMERRGAVVDYHDPYVPEIPATREYAELAGRRSVDISADRLASFDAVVITTDHDAIDWK
TVVEGAKLVVDTRNVCARFHVSAPNVVKA