Protein Info for SM_b21051 in Sinorhizobium meliloti 1021
Annotation: udpglucosegdpmannose dehydrogenase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 55% identical to UGND_PSEAE: UDP-N-acetyl-D-glucosamine 6-dehydrogenase (wbpA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
KEGG orthology group: K13015, UDP-N-acetyl-D-glucosamine dehydrogenase [EC: 1.1.1.-] (inferred from 100% identity to sme:SM_b21051)MetaCyc: 55% identical to UDP-N-acetyl-D-glucosamine 6-dehydrogenase monomer (Pseudomonas aeruginosa PAO1)
UDP-N-acetylglucosamine 6-dehydrogenase. [EC: 1.1.1.136]
Predicted SEED Role
"UDP-glucose dehydrogenase (EC 1.1.1.22)" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance ) or Teichuronic acid biosynthesis (EC 1.1.1.22)
MetaCyc Pathways
- UDP-α-D-xylose biosynthesis (2/2 steps found)
- UDP-α-D-glucuronate biosynthesis (from UDP-glucose) (1/1 steps found)
- superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
- UDP-N-acetyl-α-D-galactosaminuronate biosynthesis (1/2 steps found)
- colanic acid building blocks biosynthesis (6/11 steps found)
- UDP-sugars interconversion (4/9 steps found)
- UDP-2,3-diacetamido-2,3-dideoxy-α-D-mannuronate biosynthesis (1/5 steps found)
- teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)
- superpathway of UDP-N-acetylglucosamine-derived O-antigen building blocks biosynthesis (6/24 steps found)
KEGG Metabolic Maps
- Alkaloid biosynthesis I
- Aminosugars metabolism
- Ascorbate and aldarate metabolism
- Benzoate degradation via CoA ligation
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of type II polyketide products
- Biosynthesis of unsaturated fatty acids
- Bisphenol A degradation
- Butanoate metabolism
- C21-Steroid hormone metabolism
- Fructose and mannose metabolism
- Glycine, serine and threonine metabolism
- Insect hormone biosynthesis
- Linoleic acid metabolism
- Nucleotide sugars metabolism
- Pentose and glucuronate interconversions
- Polyketide sugar unit biosynthesis
- Retinol metabolism
- Starch and sucrose metabolism
- Tetrachloroethene degradation
Isozymes
Compare fitness of predicted isozymes for: 1.1.1.-, 1.1.1.22
Use Curated BLAST to search for 1.1.1.- or 1.1.1.136 or 1.1.1.22
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q92VR9 at UniProt or InterPro
Protein Sequence (449 amino acids)
>SM_b21051 udpglucosegdpmannose dehydrogenase (Sinorhizobium meliloti 1021) MQHMNTGPDAEKLLNRIRTRDFTIGIMGLGYVGLPLAMSSLEAGFRVIGFDIDQSRVALL NRGESGIKHLPGPAIQQAVESKRFRATSDFSELSMPDAILIAVPTPLTRNREPNLSFVEN SARSIAERLRPGQLVVLESTTWPGTTREIVRPLLEATNLVVGKDFFLAYSPEREDPGNEV HTTTSVPKVIGADEPSSLEVAQALYSQIIVRTVPVTSTATAEAVKLTENIFRSVNIALVN ELKVIFDRMGIDVWEVIEAAKTKPFGYMAFYPGPGLGGHCIPIDPFYLTWKAREYEVATR FIELAGEVNTNMPHYVVDRLVEALDRRARRGLNESRILLIGMAYKKNVGDTRESPSLRLI DLMERRGAVVDYHDPYVPEIPATREYAELAGRRSVDISADRLASFDAVVITTDHDAIDWK TVVEGAKLVVDTRNVCARFHVSAPNVVKA