Protein Info for SM_b21042 in Sinorhizobium meliloti 1021

Annotation: peptidase T

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 TIGR01882: peptidase T" amino acids 10 to 411 (402 residues), 327.2 bits, see alignment E=7.3e-102 PF01546: Peptidase_M20" amino acids 146 to 406 (261 residues), 52 bits, see alignment E=1.3e-17 PF05343: Peptidase_M42" amino acids 147 to 209 (63 residues), 25.5 bits, see alignment E=9.9e-10 PF07687: M20_dimer" amino acids 213 to 314 (102 residues), 38.9 bits, see alignment E=1.1e-13

Best Hits

Swiss-Prot: 100% identical to Y614_RHIME: Peptidase T-like protein RB0614 (RB0614) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K01258, tripeptide aminopeptidase [EC: 3.4.11.4] (inferred from 100% identity to sme:SM_b21042)

Predicted SEED Role

"Tripeptide aminopeptidase (EC 3.4.11.4)" (EC 3.4.11.4)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.11.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92VT5 at UniProt or InterPro

Protein Sequence (413 amino acids)

>SM_b21042 peptidase T (Sinorhizobium meliloti 1021)
MRMKSMRVREELVSRFFRYAAIESQSNGRSQSLPSSPGQAALAALLADEMRAIGLEDVCI
DAHAIVTGVKRGNRPAAPPIGFIAHLDTVDVGLSPFVRPQVLRFEGEDLCINRQEDIWLR
VAEHPEILDWLGEDIIVGDGTSVLGADNKAAIAVIMTLLGRLDHEVGHGDVFVAFVPDEE
IGMRGAKAMDVSRFPCDFAYTIDCCELGEVVLETFNAASCEIVFTGVSAHPMSAKGMLVN
PLLMAMDFISHFDRKETPECTEGRDGFYWFKDLIANDSVASLTALIRDFDTDGFNRRKHR
IAAVAEQMRSRYPTGNVRYQITDTYRNVSTSLARDERAVALLFKAMEELGIGKKVIAMRG
GTDGAVLSAKGIPTPNFFTGAYNFHSRYEFLPVPAFERSLEVALKVCQLAATE