Protein Info for SM_b21023 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 104 PF03992: ABM" amino acids 1 to 76 (76 residues), 84.7 bits, see alignment E=2e-28

Best Hits

Swiss-Prot: 48% identical to LSRG_KLEP7: (4S)-4-hydroxy-5-phosphonooxypentane-2,3-dione isomerase (lsrG) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K11530, autoinducer 2-degrading protein (inferred from 99% identity to smk:Sinme_5077)

MetaCyc: 42% identical to (4S)-4-hydroxy-5-phosphonooxypentane-2,3-dione isomerase (Escherichia coli K-12 substr. MG1655)
RXN-15216 [EC: 5.3.1.32]; RXN0-6720 [EC: 5.3.1.32]

Predicted SEED Role

"Autoinducer 2 (AI-2) modifying protein LsrG" in subsystem Autoinducer 2 (AI-2) transport and processing (lsrACDBFGE operon)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.32

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92VV2 at UniProt or InterPro

Protein Sequence (104 amino acids)

>SM_b21023 hypothetical protein (Sinorhizobium meliloti 1021)
MLIQMVSINVKQGHAADFLEAFRINYEGTRQEPGNLRFDVLRNPDDDHSFVIYEVFKSPE
ALDAHRKTEHYQECVRRIDPILAGPRTKTFYNVEMADFLAAGQA