Protein Info for SM_b21021 in Sinorhizobium meliloti 1021

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 PF04198: Sugar-bind" amino acids 66 to 311 (246 residues), 224.5 bits, see alignment E=1.4e-70

Best Hits

Swiss-Prot: 45% identical to LSRR_KLEP7: Transcriptional regulator LsrR (lsrR) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K11531, lsr operon transcriptional repressor (inferred from 100% identity to smk:Sinme_5079)

Predicted SEED Role

"LsrR, transcriptional repressor of lsr operon" in subsystem Autoinducer 2 (AI-2) transport and processing (lsrACDBFGE operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92VV4 at UniProt or InterPro

Protein Sequence (315 amino acids)

>SM_b21021 transcriptional regulator (Sinorhizobium meliloti 1021)
MASDNGEWSYADTDEEILTRIAWYYYNDGLTQNEIGEKLNMSRIKVSRLLESGRRSGIIQ
VRINSRYQGCLALERRIKERYGLLEAYVVPQLPDQDPSDRLGQAAAQFLMQRLQPDDLLA
VGWGATVSNTIQRLGHVANERNIGLVSLTGGVGTYVDGMRTANWGSSVHLVPAPLVVRDP
DVARNLSSEPAVANLLEMALNASYQLVGIGELSATSTVVRSGYVSPDEVEPLRRKGAVGD
ILCQFYNECGEPLELPLHDRVIGVKLAALSRAEKVVAAAGGIHKVQAIHAALCGKVVGIL
ITDETTASRLIELED