Protein Info for SM_b21010 in Sinorhizobium meliloti 1021

Annotation: D-beta-hydroxybutyrate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR01963: 3-hydroxybutyrate dehydrogenase" amino acids 3 to 258 (256 residues), 412.5 bits, see alignment E=2.8e-128 PF00106: adh_short" amino acids 3 to 197 (195 residues), 190.4 bits, see alignment E=3.8e-60 PF08659: KR" amino acids 4 to 159 (156 residues), 32.5 bits, see alignment E=1.2e-11 PF13561: adh_short_C2" amino acids 11 to 256 (246 residues), 184.9 bits, see alignment E=2.9e-58

Best Hits

Swiss-Prot: 100% identical to BDHA_RHIME: D-beta-hydroxybutyrate dehydrogenase (bdhA) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00019, 3-hydroxybutyrate dehydrogenase [EC: 1.1.1.30] (inferred from 99% identity to smk:Sinme_4582)

Predicted SEED Role

"D-beta-hydroxybutyrate dehydrogenase (EC 1.1.1.30)" in subsystem Polyhydroxybutyrate metabolism (EC 1.1.1.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.30

Use Curated BLAST to search for 1.1.1.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See O86034 at UniProt or InterPro

Protein Sequence (258 amino acids)

>SM_b21010 D-beta-hydroxybutyrate dehydrogenase (Sinorhizobium meliloti 1021)
MTKTAVITGSTSGIGLAIARTLAKAGANIVLNGFGAPDEIRTVTDEVAGLSSGTVLHHPA
DMTKPSEIADMMAMVADRFGGADILVNNAGVQFVEKIEDFPVEQWDRIIAVNLSSSFHTI
RGAIPPMKKKGWGRIINIASAHGLVASPFKSAYVAAKHGIMGLTKTVALEVAESGVTVNS
ICPGYVLTPLVEKQIPDQARTRGITEEQVINEVMLKGQPTKKFITVEQVASLALYLAGDD
AAQITGTHVSMDGGWTAQ