Protein Info for SM_b21002 in Sinorhizobium meliloti 1021

Annotation: methionine aminopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 TIGR00500: methionine aminopeptidase, type I" amino acids 1 to 246 (246 residues), 235.4 bits, see alignment E=3.6e-74 PF00557: Peptidase_M24" amino acids 10 to 238 (229 residues), 137.7 bits, see alignment E=2.4e-44

Best Hits

Swiss-Prot: 45% identical to MAP1_STAAM: Methionine aminopeptidase (map) from Staphylococcus aureus (strain Mu50 / ATCC 700699)

KEGG orthology group: K01265, methionyl aminopeptidase [EC: 3.4.11.18] (inferred from 100% identity to sme:SM_b21002)

Predicted SEED Role

"Methionine aminopeptidase (EC 3.4.11.18)" (EC 3.4.11.18)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.4.11.18

Use Curated BLAST to search for 3.4.11.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92UK0 at UniProt or InterPro

Protein Sequence (249 amino acids)

>SM_b21002 methionine aminopeptidase (Sinorhizobium meliloti 1021)
MTLNNDEDLERLKEIGRICANALQAMGEALELGITTAELDAIGRKVLEDAGARSAPELCY
DFPGATCISVNEEIAHGIPGRRVIQPGDLVNIDVSAEKGGLFADTGASFPVPPVKTEIDR
LCRDGKRAMWVGLKQVKPGQSLAAIGNSIGEFARKNRYSLVANLASHGIGRSLHEEPSEI
ATWPDPSERRRMTEGMVFTVEPFLSMGAQWAEGGDDDWTLYSEPRAPTVQYEHTVVVTRS
GPLVVTLPG