Protein Info for SM_b20995 in Sinorhizobium meliloti 1021

Annotation: GTP-binding protein EngA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 476 PF01926: MMR_HSR1" amino acids 4 to 120 (117 residues), 104.4 bits, see alignment E=2.4e-33 amino acids 206 to 324 (119 residues), 78.6 bits, see alignment E=2.4e-25 TIGR00231: small GTP-binding protein domain" amino acids 4 to 159 (156 residues), 85.9 bits, see alignment E=4e-28 amino acids 203 to 371 (169 residues), 89.7 bits, see alignment E=2.7e-29 TIGR03594: ribosome-associated GTPase EngA" amino acids 4 to 462 (459 residues), 545.7 bits, see alignment E=1.3e-167 PF02421: FeoB_N" amino acids 4 to 158 (155 residues), 49.6 bits, see alignment E=2e-16 amino acids 206 to 372 (167 residues), 39.2 bits, see alignment E=3.1e-13 PF00071: Ras" amino acids 5 to 123 (119 residues), 21.7 bits, see alignment E=8.1e-08 PF00009: GTP_EFTU" amino acids 206 to 374 (169 residues), 35.5 bits, see alignment E=4.7e-12 PF04548: AIG1" amino acids 206 to 310 (105 residues), 28.1 bits, see alignment E=7.6e-10 PF14714: KH_dom-like" amino acids 382 to 462 (81 residues), 107.6 bits, see alignment E=2e-34

Best Hits

Swiss-Prot: 100% identical to DER_RHIME: GTPase Der (der) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K03977, GTP-binding protein (inferred from 100% identity to smk:Sinme_4597)

Predicted SEED Role

"GTP-binding protein EngA" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92UK6 at UniProt or InterPro

Protein Sequence (476 amino acids)

>SM_b20995 GTP-binding protein EngA (Sinorhizobium meliloti 1021)
MSFTVAIIGRPNVGKSTLFNRLVGKKLALVDDTPGVTRDRRPGDAKLVDLKFRIIDTAGL
EESSPDSLQGRMWAQTEAAIDEADLSLFVVDAKAGLTPADQTLAEMLRRRGKPVVVVANK
SEARGSEGGFYDAFTLGLGEPCPISAEHGQGMLDLRDAIVAALGEERAFPPAEDVAETNV
DIRPVAGEGTEDEEVEPAYDETKPLRVAIVGRPNAGKSTLINRFLGEDRLLTGPEAGITR
DSISVEWDWRGRTIKMFDTAGMRRKAKVQEKLEKLSVADALRAIRFAETVVIVFDATIPF
EKQDLQIVDLVLREGRAAVLAFNKWDLVENWQALLVDLREKTERLLPQARGIRAVPISGH
TGYGLDRLMQAIIETDKVWNRRISTARLNRWLESQQVQHPPPAVSGRRLKLKYMTQVKAR
PPGFMISCTRPEAVPESYTRYLINGLRNDFDLPGVPIRVHFRASENPFESKARKRR