Protein Info for SM_b20993 in Sinorhizobium meliloti 1021

Annotation: FMNH2-dependent monooxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 TIGR04022: sulfur acquisition oxidoreductase, SfnB family" amino acids 16 to 399 (384 residues), 511.7 bits, see alignment E=6.2e-158 PF02771: Acyl-CoA_dh_N" amino acids 28 to 127 (100 residues), 45 bits, see alignment E=2.6e-15 PF02770: Acyl-CoA_dh_M" amino acids 147 to 221 (75 residues), 35.4 bits, see alignment E=1.9e-12 PF00441: Acyl-CoA_dh_1" amino acids 233 to 375 (143 residues), 39.8 bits, see alignment E=1e-13 PF08028: Acyl-CoA_dh_2" amino acids 247 to 375 (129 residues), 58.5 bits, see alignment E=1.8e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SM_b20993)

Predicted SEED Role

"Acyl-CoA dehydrogenase; probable dibenzothiophene desulfurization enzyme"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92UK8 at UniProt or InterPro

Protein Sequence (403 amino acids)

>SM_b20993 FMNH2-dependent monooxygenase (Sinorhizobium meliloti 1021)
MGNISQFAGKTKPTPHRIESEEEALAIARELALRFSDRASERDLERVLPHDELDQLAQSG
LLAISIPSEYEGIDVSNVVLAEITAILSEADSSIGQIPQGHFYVLEALRQHATEEQKQFF
FGRAMAGDRFGSALSESGDKIIGDDKTRITGNGAGYRINGRKQYCTGVLFADWLAISALD
AADRMTISFVPRAAEGVRIIDDWDSFGQRVTGSGTAVLENVHVDLGSVVPHHRGFERPNT
VRSVGQIIHAGVDLGIARAAFRETLDLVRDAAAAKGSGMERASEDALTTARVGEVAIRLE
AATALIEHAGRKVDTAQVDPTEEHAVEASLSVTAAKVLAAEAALEAANALFDLAGSASAK
VALNLDRYWRNARAHALQDPVRWKHHLVGNYHLKGVKPRSGLL