Protein Info for SM_b20970 in Sinorhizobium meliloti 1021

Annotation: sugar uptake ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 transmembrane" amino acids 25 to 52 (28 residues), see Phobius details amino acids 86 to 110 (25 residues), see Phobius details amino acids 122 to 143 (22 residues), see Phobius details amino acids 170 to 193 (24 residues), see Phobius details amino acids 213 to 239 (27 residues), see Phobius details amino acids 243 to 266 (24 residues), see Phobius details amino acids 277 to 300 (24 residues), see Phobius details PF00528: BPD_transp_1" amino acids 101 to 299 (199 residues), 55.3 bits, see alignment E=3.8e-19

Best Hits

Swiss-Prot: 39% identical to YESP_BACSU: Probable ABC transporter permease protein YesP (yesP) from Bacillus subtilis (strain 168)

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 100% identity to sme:SM_b20970)

Predicted SEED Role

"N-Acetyl-D-glucosamine ABC transport system, permease protein 1" in subsystem Chitin and N-acetylglucosamine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92UM9 at UniProt or InterPro

Protein Sequence (319 amino acids)

>SM_b20970 sugar uptake ABC transporter permease (Sinorhizobium meliloti 1021)
MDMAAHTGPKAEVVRRRRANAGRHLAPFLFISPWILGFLFFTLGPLCFSLTMSFFDWPVV
GERTFVGLDNYRSMFMEDPQFRESLWITVKFAAIYVPFNIVMSFLLALLLHHATFASGFF
RTVFYLPSVISGVALVTIWSWIYSREYGLLNFMLSLVGIDGPNWLGDPSLALVAIIVASL
WGLGGTMLILLTGLKAIPKELYEAATVSGVPGWAQMVFITLPMLGPMLIFTFITSIISAF
QQLTIALLLTKGGPLGSTYFFAMYIYDNAFKYFDMGYAAAGSWVMFVIVLTLSLVVMRWS
AAWVYYEGEVRPADGDRDA