Protein Info for SM_b20969 in Sinorhizobium meliloti 1021

Annotation: sugar uptake ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 signal peptide" amino acids 5 to 6 (2 residues), see Phobius details amino acids 25 to 26 (2 residues), see Phobius details transmembrane" amino acids 7 to 24 (18 residues), see Phobius details amino acids 68 to 90 (23 residues), see Phobius details amino acids 100 to 121 (22 residues), see Phobius details amino acids 136 to 155 (20 residues), see Phobius details amino acids 176 to 198 (23 residues), see Phobius details amino acids 234 to 255 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 86 to 259 (174 residues), 60.4 bits, see alignment E=1e-20

Best Hits

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 100% identity to sme:SM_b20969)

Predicted SEED Role

"N-Acetyl-D-glucosamine ABC transport system, permease protein 2" in subsystem Chitin and N-acetylglucosamine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92UN0 at UniProt or InterPro

Protein Sequence (270 amino acids)

>SM_b20969 sugar uptake ABC transporter permease (Sinorhizobium meliloti 1021)
MRKTVLYATLILLSALFIAPFYWTFMTAVKSTAELYRFPPVLWPSEWHWENFAAAWSKQP
FGTYLSNSLIVVVLSTIGQLLSSSLVAFGFARFRFPGRDALFVLLLATMMIPWDVKMIPL
YMEFNMLGWINTLKPLIVPAYFADAFFVFLLRQYIMTIPMEIDEAARMDGANSFDIYWRI
HLPLMLPALVLVGTFHFMNAWNDYLGPLIFLNDQSKYTLTLGLSMFKGLHEIDVTSIAAI
TVILCLPPLALFFLAQRYIMDGAVGSSVKG