Protein Info for SM_b20962 in Sinorhizobium meliloti 1021

Annotation: phoshomethylpyrimidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to THID_RHIME: Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase (thiD) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00941, hydroxymethylpyrimidine/phosphomethylpyrimidine kinase [EC: 2.7.1.49 2.7.4.7] (inferred from 100% identity to smk:Sinme_4627)

MetaCyc: 51% identical to bifunctional hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase (Escherichia coli K-12 substr. MG1655)
Phosphomethylpyrimidine kinase. [EC: 2.7.4.7]; Hydroxymethylpyrimidine kinase. [EC: 2.7.4.7, 2.7.1.49]

Predicted SEED Role

No annotation

MetaCyc Pathways

4-amino-2-methyl-5-diphosphomethylpyrimidine biosynthesis I (2/2 steps found)
hydroxymethylpyrimidine salvage (2/2 steps found)
thiamine diphosphate salvage II (3/5 steps found)
superpathway of thiamine diphosphate biosynthesis II (7/11 steps found)
superpathway of thiamine diphosphate biosynthesis III (eukaryotes) (4/7 steps found)
thiamine diphosphate salvage IV (yeast) (4/7 steps found)
4-amino-2-methyl-5-diphosphomethylpyrimidine biosynthesis II (4/8 steps found)
thiamine diphosphate formation from pyrithiamine and oxythiamine (yeast) (4/8 steps found)
superpathway of thiamine diphosphate biosynthesis I (5/10 steps found)

KEGG Metabolic Maps

Thiamine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.49 or 2.7.4.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P56904 at UniProt or InterPro

Protein Sequence (266 amino acids)

>SM_b20962 phoshomethylpyrimidine kinase (Sinorhizobium meliloti 1021)
MTAIALSIAGSDSGGGAGIQADLKTFSALGVYGASVITAITAQNTRGVTAVEDVSAEIVS
AQMDAVFSDLDVKAVKIGMVSRRETIAAIADGLRRFGKRAVVDPVMVATSGDALLRPDAV
AALIEELLPLALVVTPNLAEAALMTGRAIAGDEAEMARQAEAIMRTGAHAVLVKGGHLKG
QEATDLFFDGDTLVRLPAGRIETRNDHGTGCTLSAAIAAGLAKGVPLIEAVSAAKAYLHA
AISAADRLEIGQGRGPVHHFHRWWKD