Protein Info for SM_b20954 in Sinorhizobium meliloti 1021

Annotation: succinyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 transmembrane" amino acids 9 to 27 (19 residues), see Phobius details amino acids 47 to 69 (23 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 128 to 147 (20 residues), see Phobius details amino acids 156 to 181 (26 residues), see Phobius details amino acids 187 to 208 (22 residues), see Phobius details amino acids 217 to 237 (21 residues), see Phobius details amino acids 249 to 269 (21 residues), see Phobius details amino acids 281 to 302 (22 residues), see Phobius details amino acids 308 to 327 (20 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 8 to 326 (319 residues), 109.8 bits, see alignment E=7.7e-36

Best Hits

Swiss-Prot: 100% identical to EXOH_RHIME: Succinoglycan biosynthesis protein ExoH (exoH) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_4636)

MetaCyc: 100% identical to succinyltransferase ExoH (Sinorhizobium meliloti 1021)
RXN-21329

Predicted SEED Role

"STRUCTURAL ELEMENTS; Cell Exterior; surface polysaccharides/antigens"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P33692 at UniProt or InterPro

Protein Sequence (370 amino acids)

>SM_b20954 succinyltransferase (Sinorhizobium meliloti 1021)
MDANVSARINLMRILLISGIVFVHVPYNPQWSPFLGNYGMLDWLRVFLGESLFRIGVPCL
SAISGYLLFRRGLADFDYWKTLKTKARTVLLPFLIWSGSFFVVVYAIQRQGLGFGYLPDT
INATPRQWLSMAFAVEATPVNLPLYFLRDLMLCILLSPLLALLVSRYPRVTLLALLAYAI
LPLPNGIFLKKSILFGFSAGIYASLHGVNIKMLDRFAAPIAAGFLAIAVVIAVGLYYTGP
DFPLWLDMALRLTSIAGIIGSWAISELLVRTRFGEKLGRGSGLSFWIFCGHYPLLVLFWM
IWNRTGLSYYPLFYFTAPFIAIAILVASHNLVRRLAPDLLAVLTGSRTGAKRMATQPPQG
AQAGYSPQQR