Protein Info for SM_b20948 in Sinorhizobium meliloti 1021
Annotation: glucosyltransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to EXOU_RHIME: Succinoglycan biosynthesis protein ExoU (exoU) from Rhizobium meliloti (strain 1021)
KEGG orthology group: None (inferred from 100% identity to sme:SM_b20948)MetaCyc: 100% identical to glucosyltransferase ExoU (Sinorhizobium meliloti 1021)
2.4.1.-
Predicted SEED Role
"STRUCTURAL ELEMENTS; Cell Exterior; surface polysaccharides/antigens"
MetaCyc Pathways
- succinoglycan biosynthesis (13/14 steps found)
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See P33700 at UniProt or InterPro
Protein Sequence (342 amino acids)
>SM_b20948 glucosyltransferase (Sinorhizobium meliloti 1021) MTAAAPTDVCIIISAKNAADTIARAVASALAEPEAAEVVVIDDGSTDDSASVARAADDGT GRLNVVRFEENRGPAAARNHAIAISHSPLIGVLDADDFFFPGRLGQLLSQDGWDFIADNI AFIDAAQAATAHGRIDRFAPTPRLIDLVGFVEGNISRRGVRRGEIGFLKPLMRRAFLDQH GLRYNETLRLGEDYDLYARALANGARYKIIHSCGYAAVVRGNSLSGSHRTIDLKRLYEAD RAILAGSRLSSDAEAAVRRHERHIRDRYELRHFLDLKNQQGFGRAFGYALTHPAALPAII GGILADKTERFRPSGSPAPVALGGKGDVRYLLETLAVDQPQK