Protein Info for SM_b20946 in Sinorhizobium meliloti 1021

Annotation: galactosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 transmembrane" amino acids 32 to 55 (24 residues), see Phobius details PF02397: Bac_transf" amino acids 29 to 219 (191 residues), 206.8 bits, see alignment E=9.7e-66

Best Hits

Swiss-Prot: 100% identical to EXOY_RHIME: Exopolysaccharide production protein ExoY (exoY) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_4644)

MetaCyc: 100% identical to undecaprenyl-phosphate galactose phosphotransferase (Sinorhizobium meliloti 1021)
Undecaprenyl-phosphate galactose phosphotransferase. [EC: 2.7.8.6]

Predicted SEED Role

"Undecaprenyl-phosphate galactosephosphotransferase (EC 2.7.8.6)" (EC 2.7.8.6)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.6

Use Curated BLAST to search for 2.7.8.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q02731 at UniProt or InterPro

Protein Sequence (226 amino acids)

>SM_b20946 galactosyltransferase (Sinorhizobium meliloti 1021)
MKSATRSASSPFFIPEETGAVRPIGGMAKRSFDVLAASVALLLFSPLFLLIMALVKFSDG
GSVFYGHRRIGHNGQSFKCLKFRTMMEKGDEVLEEFFRINPDAYEEWRATRKLQNDPRVT
VVGAVLRKLSLDELPQLLNIIRGEMSVVGPRPVVEDELELYDSAAVFYLRSRPGLTGLWQ
ISGRNDVSYATRVAFDTQYVQNWSLFADLVIVFKTIPAVCLSRGSY