Protein Info for SM_b20942 in Sinorhizobium meliloti 1021

Annotation: UDP glucose 4-epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04321: RmlD_sub_bind
  • amino acids 5 to 169 (165 residues), 54.5 bits, E=3e-18
• TIGR01179: UDP-glucose 4-epimerase GalE
  • amino acids 5 to 326 (322 residues), 428.1 bits, E=9.5e-133
• PF01370: Epimerase
  • amino acids 6 to 254 (249 residues), 179.2 bits, E=2.9e-56
• PF02719: Polysacc_synt_2
  • amino acids 6 to 173 (168 residues), 49.1 bits, E=1.4e-16
• PF16363: GDP_Man_Dehyd
  • amino acids 7 to 314 (308 residues), 188.8 bits, E=5.7e-59
• PF01073: 3Beta_HSD
  • amino acids 7 to 154 (148 residues), 51.8 bits, E=1.8e-17
• PF07993: NAD_binding_4
  • amino acids 70 to 182 (113 residues), 30.4 bits, E=6.7e-11

Best Hits

Swiss-Prot: 100% identical to EXOB_RHIME: UDP-glucose 4-epimerase (exoB) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K01784, UDP-glucose 4-epimerase [EC: 5.1.3.2] (inferred from 100% identity to sme:SM_b20942)

MetaCyc: 54% identical to UDP-xylose 4-epimerase subunit (Sinorhizobium meliloti 1021)
UDP-arabinose 4-epimerase. [EC: 5.1.3.5]

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

• UDP-α-D-galactose biosynthesis (1/1 steps found)
• UDP-β-L-arabinose biosynthesis I (from UDP-α-D-xylose) (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis I (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (5/7 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• UDP-α-D-galactofuranose biosynthesis (1/2 steps found)
• D-galactose degradation I (Leloir pathway) (3/5 steps found)
• stachyose degradation (4/7 steps found)
• D-galactose detoxification (1/3 steps found)
• colanic acid building blocks biosynthesis (6/11 steps found)
• UDP-sugars interconversion (4/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)
• mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (1/18 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 5.1.3.2 or 5.1.3.5

Sequence Analysis Tools

See P26503 at UniProt or InterPro

Protein Sequence (328 amino acids)

>SM_b20942 UDP glucose 4-epimerase (Sinorhizobium meliloti 1021)
MQNNNILVVGGAGYIGSHTCLQLAAKGYQPVVYDNLSNGHEEFVKWGVLEKGDIRDRQRL
DEVLARHKPRAILHFAAMIEVGESVKDPAAFYDNNVIGTLTLLSAALAAGIDAFVFSSTC
ATYGLPDSVPMDESHKQAPINPYGRTKWICEQALKDYGLYKGLRSVILRYFNAAGADFEG
RIGEWHEPETHAIPLAIDAALGRREGFKVFGTDYDTRDGTCVRDYIHVLDLADAHVRAVD
YLLEGGESVALNLGTGTGTTVKELLDAIEKVAKRPFNIGYAERREGDSTTLVANNDKARQ
VLGWEPQYDLAAITESAWNWHSRRNQGG