Protein Info for SM_b20942 in Sinorhizobium meliloti 1021

Annotation: UDP glucose 4-epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 TIGR01179: UDP-glucose 4-epimerase GalE" amino acids 5 to 326 (322 residues), 428.1 bits, see alignment E=9.5e-133 PF04321: RmlD_sub_bind" amino acids 5 to 169 (165 residues), 54.5 bits, see alignment E=3e-18 PF01370: Epimerase" amino acids 6 to 254 (249 residues), 179.2 bits, see alignment E=2.9e-56 PF02719: Polysacc_synt_2" amino acids 6 to 173 (168 residues), 49.1 bits, see alignment E=1.4e-16 PF01073: 3Beta_HSD" amino acids 7 to 154 (148 residues), 51.8 bits, see alignment E=1.8e-17 PF16363: GDP_Man_Dehyd" amino acids 7 to 314 (308 residues), 188.8 bits, see alignment E=5.7e-59 PF07993: NAD_binding_4" amino acids 70 to 182 (113 residues), 30.4 bits, see alignment E=6.7e-11

Best Hits

Swiss-Prot: 100% identical to EXOB_RHIME: UDP-glucose 4-epimerase (exoB) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K01784, UDP-glucose 4-epimerase [EC: 5.1.3.2] (inferred from 100% identity to sme:SM_b20942)

MetaCyc: 54% identical to UDP-xylose 4-epimerase subunit (Sinorhizobium meliloti 1021)
UDP-arabinose 4-epimerase. [EC: 5.1.3.5]

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 5.1.3.2 or 5.1.3.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P26503 at UniProt or InterPro

Protein Sequence (328 amino acids)

>SM_b20942 UDP glucose 4-epimerase (Sinorhizobium meliloti 1021)
MQNNNILVVGGAGYIGSHTCLQLAAKGYQPVVYDNLSNGHEEFVKWGVLEKGDIRDRQRL
DEVLARHKPRAILHFAAMIEVGESVKDPAAFYDNNVIGTLTLLSAALAAGIDAFVFSSTC
ATYGLPDSVPMDESHKQAPINPYGRTKWICEQALKDYGLYKGLRSVILRYFNAAGADFEG
RIGEWHEPETHAIPLAIDAALGRREGFKVFGTDYDTRDGTCVRDYIHVLDLADAHVRAVD
YLLEGGESVALNLGTGTGTTVKELLDAIEKVAKRPFNIGYAERREGDSTTLVANNDKARQ
VLGWEPQYDLAAITESAWNWHSRRNQGG