Protein Info for SM_b20937 in Sinorhizobium meliloti 1021

Annotation: ABC transporter ATP-binding protein/permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 606 transmembrane" amino acids 43 to 64 (22 residues), see Phobius details amino acids 84 to 104 (21 residues), see Phobius details amino acids 168 to 191 (24 residues), see Phobius details amino acids 203 to 222 (20 residues), see Phobius details amino acids 295 to 322 (28 residues), see Phobius details PF06472: ABC_membrane_2" amino acids 36 to 312 (277 residues), 101.8 bits, see alignment E=6.9e-33 PF05992: SbmA_BacA" amino acids 44 to 360 (317 residues), 83.4 bits, see alignment E=3.1e-27 PF00005: ABC_tran" amino acids 405 to 534 (130 residues), 31.9 bits, see alignment E=2.8e-11

Best Hits

KEGG orthology group: K02471, putative ATP-binding cassette transporter (inferred from 100% identity to sme:SM_b20937)

Predicted SEED Role

"ABC TRANSPORTER ATP-BINDING PROTEIN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7ANP2 at UniProt or InterPro

Protein Sequence (606 amino acids)

>SM_b20937 ABC transporter ATP-binding protein/permease (Sinorhizobium meliloti 1021)
MKNQTGNETRARTPATPSEGSSIWQQFEMMRHAFVASPVLKPILWLAAGSFTIIIVTAIG
QIVLNRWYRPFFDAIERRDLNSFFYQLMLFVLLAGVLLVFNVAQQWLNQMVRLKLREGLT
LDLIGEWMRPRRAFRLANAGTIGVNPDQRMQEDAGHLADLTTSLGFGLLQSSILLISFVG
VLWSLSAGFAFQIGERSLEIPGYMVWAAILYAGSASWLSWLVGRRLIVLNGERYAREADL
RFSMMHANEHIDGISLAGGEAGERRRLQLDLSSVLDATRKIFRAEINLAWVQDGYGWVTV
VAPILVAAPVYFAGNISFGGLMMAVGAFNQVHSSLKWFVANVSAITDWRATLLRVAAFRR
ALITADTLHGDEKRIEFVENESATMTFENLEVVSRSGRTRLAESRIEISPGQRVNIIGDP
RAGKTLVFRALAGLWPWGNGRVGMPAGEAVAFIPRAPYFPRGRLRDALAYPHADSFPDKV
LVTALSKVGLDHLATSLDREARWERELGDDEQRLLAFARLLVQKPRWVVIDEALETMDAD
ALKRALSIFEADLRETAVIKIGRTPRNGVQFSRVIHLVKDAEAPALKPVRLGGGVSGLEV
AARGAP