Protein Info for SM_b20930 in Sinorhizobium meliloti 1021

Annotation: sugar uptake ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 PF00005: ABC_tran" amino acids 20 to 172 (153 residues), 118.3 bits, see alignment E=6.2e-38

Best Hits

KEGG orthology group: K02056, simple sugar transport system ATP-binding protein [EC: 3.6.3.17] (inferred from 100% identity to smk:Sinme_4659)

Predicted SEED Role

"Ferric hydroxamate ABC transporter (TC 3.A.1.14.3), ATP-binding protein FhuC" in subsystem Iron acquisition in Vibrio or Siderophore Aerobactin (TC 3.A.1.14.3)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.17

Use Curated BLAST to search for 3.6.3.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92UP2 at UniProt or InterPro

Protein Sequence (246 amino acids)

>SM_b20930 sugar uptake ABC transporter ATP-binding protein (Sinorhizobium meliloti 1021)
MAVLELVNISKHFGAIQAVSDVSLSLERGEVVGLMGDNGAGKSTLVKMMAGNFRPSHGTI
RLDGAELVMHRPVEARQHGIEIVYQDLALCDNLTAAANVFLGREIRRGIGPLRILDYKAM
YRRAGEIFRELKSETPPRNLVRQMSGGQRQAVAIARTMLSEAKIVLMDEPTAAISVRQVA
EVLNLIRELRDRGIAVVLISHRMPDVFTVADRVIVMRRGRKVADKPIAASSPEEVTGLIT
GAIEQV