Protein Info for SM_b20905 in Sinorhizobium meliloti 1021

Annotation: transposase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 PF13518: HTH_28" amino acids 12 to 56 (45 residues), 34.2 bits, see alignment 5.1e-12 PF13011: LZ_Tnp_IS481" amino acids 27 to 70 (44 residues), 26 bits, see alignment 2.4e-09 PF13565: HTH_32" amino acids 33 to 109 (77 residues), 53 bits, see alignment E=1.1e-17 PF00665: rve" amino acids 135 to 239 (105 residues), 44.9 bits, see alignment E=3.1e-15 PF13683: rve_3" amino acids 228 to 292 (65 residues), 52.8 bits, see alignment E=6.7e-18

Best Hits

KEGG orthology group: K07497, putative transposase (inferred from 100% identity to sme:SM_b20905)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92UD3 at UniProt or InterPro

Protein Sequence (390 amino acids)

>SM_b20905 transposase (Sinorhizobium meliloti 1021)
MQPHGQTSQIRCAGSGWREIAVLCREFGISRKTGHKIISRYNACGLEGLTDRSRRPYRHA
NQLPFQIEKLIVRAKQEKPNWGAPKIRERLARLYPDVQTPAISTVHAVLDRNGLVEHRKR
RRNRAQGTPLSQPCRANDLWCADYKGEFMLADKRYCYPLTITDFASRYLLACEALHTTKE
VYAFTVFERVFKEFGLPRAIRTDNGVPFASPNALFNLSRLSVWWLRLGIDIERIKPGNPQ
QNGRHERMHLTLKLETTKPAGANFLQQQARFDDFVEEFNIERPHRALNMACPAECYSVSP
RPYRGLPSLDYPFHDQAVTVTTCGRICYKRKKINLSQVFAGQTVGIKQVEDHIWLTSFMQ
YDLGYFDDETCRLEPLQNPFGPKVLPMSQE