Protein Info for SM_b20886 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 469 PF04174: CP_ATPgrasp_1" amino acids 69 to 401 (333 residues), 486.1 bits, see alignment E=5e-150 PF14403: CP_ATPgrasp_2" amino acids 69 to 445 (377 residues), 550 bits, see alignment E=2.6e-169

Best Hits

Swiss-Prot: 56% identical to Y335_SYNY3: Uncharacterized protein sll0335 (sll0335) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: None (inferred from 100% identity to sme:SM_b20886)

Predicted SEED Role

"Protein containing domains DUF404, DUF407"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92UF1 at UniProt or InterPro

Protein Sequence (469 amino acids)

>SM_b20886 hypothetical protein (Sinorhizobium meliloti 1021)
MAFDEMINADSSPRQPYSTYHQWYASQDRNRLIAKSKEAEKIFRKTGITFAVYGHADSSE
KLIPFDLIPRIISGREWRRLAQGIEQRVIALNAFLDDIYHKQEIIRAGRIPRELVEKNDT
FLPQMIGFRPPGGVYTHIVGTDIVRTGEDQYYVLEDNARTPSGVSYMLENRETMMQMFPE
LFHQNRVRPVENYPNLLRQSLSSLAPAGCEGKPRVAVLTPGIYNSAFYEHAFLADMMGVE
LVEGSDLRVIDGRVKMRTTRGYEAIDVLYRRVDDDFLDPLTFRPDSALGIPGIMDVYRAG
NITIANAPGTGISDDKAIYSYMPEIVEFYTGRKPLLENVPTWRCSEPESLKYVLEHLAEL
VVKEVHGSGGYGMLVGPTATKKECAAFAEKLKSRPGNYIAQPTLSLSTVPIMVNKGIAPR
HVDLRPYVLVSDKVQIIPGGLTRVALKEGSLVVNSSQGGGTKDTWVLED