Protein Info for SM_b20854 in Sinorhizobium meliloti 1021

Annotation: sugar uptake ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 transmembrane" amino acids 22 to 43 (22 residues), see Phobius details amino acids 55 to 75 (21 residues), see Phobius details amino acids 82 to 103 (22 residues), see Phobius details amino acids 109 to 129 (21 residues), see Phobius details amino acids 135 to 153 (19 residues), see Phobius details amino acids 173 to 198 (26 residues), see Phobius details amino acids 225 to 245 (21 residues), see Phobius details amino acids 252 to 274 (23 residues), see Phobius details amino acids 281 to 302 (22 residues), see Phobius details amino acids 309 to 327 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 53 to 320 (268 residues), 131.9 bits, see alignment E=1.2e-42

Best Hits

Swiss-Prot: 41% identical to RBSC_BACSU: Ribose import permease protein RbsC (rbsC) from Bacillus subtilis (strain 168)

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 100% identity to sme:SM_b20854)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92UI3 at UniProt or InterPro

Protein Sequence (331 amino acids)

>SM_b20854 sugar uptake ABC transporter permease (Sinorhizobium meliloti 1021)
MTHTTDTVMPQEQKGFVDYHSIVQRFGTLAIFLVLVAVATWWSDSFLTRGNLLNVLRQVA
STAGIMAVGMLFVILTRGIDLSVGSVMALGSVLTGYFCAMLGYGTGATIFLVLLCGAACG
LVTGGFIAYLRLPSFVMSLAMMAVARGLSLIISEGRPIPLSDAGAAFSSFGSGFVLGIPQ
PVILMFAIYIAGGVVLNFTRFGRVITAIGSNEEAVRLSGIAVPRYIVAVYVISGLLAGLA
GIIAASRTGVGSAQVGIGAELNVIAAVVIGGASLMGGKGGVINTLLGALVMGIITNIMNL
AGVPGYHQQVYMGAIIVVAMLLQYSTGSLKR