Protein Info for SM_b20838 in Sinorhizobium meliloti 1021

Annotation: secreted calcium-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 353 PF00353: HemolysinCabind" amino acids 96 to 106 (11 residues), 10.6 bits, see alignment (E = 2.5e-05) amino acids 117 to 150 (34 residues), 15 bits, see alignment 1e-06 amino acids 188 to 221 (34 residues), 23.3 bits, see alignment 2.5e-09 amino acids 196 to 230 (35 residues), 27.3 bits, see alignment 1.4e-10 amino acids 205 to 239 (35 residues), 31.8 bits, see alignment 5.6e-12 amino acids 231 to 259 (29 residues), 22.6 bits, see alignment (E = 4.1e-09)

Best Hits

KEGG orthology group: None (inferred from 99% identity to sme:SMc00286)

Predicted SEED Role

"possible protease( EC:3.4.24.40 )"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92VW6 at UniProt or InterPro

Protein Sequence (353 amino acids)

>SM_b20838 secreted calcium-binding protein (Sinorhizobium meliloti 1021)
MVLPKGRAMATRIYGTNYADVIKQNGYIAVEIYAYDGDDDIYLNRTDSYGGYNFVDAGYG
NDLVVNSYEGGNDIYLGGGNDIYVADIRARDASSYDIVYGGSGNDRFEIEGYASDYYGES
GNDTFFSVGFNNYFNGGTGTDTISYQFQDDWSAERGKGVTIDLGYNYATTGSGRREDLIS
IENATGTNYGHDDITGSAVANTLRGLGGHDIIEGLGGNDVLDGGSGDDDLYGGSGADILR
GGTGFDYLVGGTGTDSFDFNSISESAVGSRRDVITDFHRSEFDVIDLSTIDADTTWSGNQ
SFTYIGGNAFSGEAGELNFRSGIISGDVNGDGYADFQVRVNGVTSLRVDDFFL