Protein Info for SM_b20833 in Sinorhizobium meliloti 1021

Annotation: cell surface polysaccharide export ABC-2 transporter permease, close relative of Y20822wzm2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 transmembrane" amino acids 32 to 53 (22 residues), see Phobius details amino acids 60 to 81 (22 residues), see Phobius details amino acids 108 to 132 (25 residues), see Phobius details amino acids 144 to 169 (26 residues), see Phobius details amino acids 175 to 192 (18 residues), see Phobius details amino acids 204 to 221 (18 residues), see Phobius details amino acids 233 to 251 (19 residues), see Phobius details PF01061: ABC2_membrane" amino acids 14 to 221 (208 residues), 46.8 bits, see alignment E=1.3e-16

Best Hits

KEGG orthology group: K09688, capsular polysaccharide transport system permease protein (inferred from 100% identity to sme:SM_b20833)

Predicted SEED Role

"STRUCTURAL ELEMENTS; Cell Exterior; surface polysaccharides/antigens"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92VX1 at UniProt or InterPro

Protein Sequence (259 amino acids)

>SM_b20833 cell surface polysaccharide export ABC-2 transporter permease, close relative of Y20822wzm2 (Sinorhizobium meliloti 1021)
MTDVGYLTTHFRVVGALLVREMATRFGSKPGGYVWALLDPAAHILLMTVIFQAIARAPAL
GTSFALFFATGYIAFQFYQAMTGYLNAAVKANKALLSYPNVAPIDTIVARFVLQMGTTSL
VAFIVLGTIVATMRVDTDIHWPSILEAVGLACLFGLGVAMVNCVLFLKYPLYEQVFSIVN
RPLFLISGVFFLPDSIPAPYRDLVLINPLVHVIMGFRKGFYPEYRAIGLDMDYLYGIAFL
TLFAGMLVFTLSRKTLRNE