Protein Info for SM_b20819 in Sinorhizobium meliloti 1021

Annotation: ferredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 105 TIGR02377: Rieske [2Fe-2S] domain protein, MocE subfamily" amino acids 4 to 103 (100 residues), 183.6 bits, see alignment E=2.8e-59 PF00355: Rieske" amino acids 4 to 92 (89 residues), 73.4 bits, see alignment E=1.2e-24 PF13806: Rieske_2" amino acids 4 to 102 (99 residues), 46.6 bits, see alignment E=2.9e-16

Best Hits

Swiss-Prot: 46% identical to NDOA_PSEAI: Naphthalene 1,2-dioxygenase system, ferredoxin component (ndoA) from Pseudomonas aeruginosa

KEGG orthology group: K05710, ferredoxin subunit of phenylpropionate dioxygenase (inferred from 99% identity to smk:Sinme_5132)

MetaCyc: 46% identical to naphthalene 1,2-dioxygenase complex ferredoxin component (Pseudomonas sp. NCIB9816-4)
Naphthalene 1,2-dioxygenase. [EC: 1.14.12.12]

Predicted SEED Role

"Naphthalene 1,2-dioxygenase system ferredoxin component"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.12.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92VY8 at UniProt or InterPro

Protein Sequence (105 amino acids)

>SM_b20819 ferredoxin (Sinorhizobium meliloti 1021)
MSSNWVEVCAAEEIDEEDVVRFDHEGRTFAVYRSPDDEYFATDGLCTHEQIHLADGLVMG
DIIECPKHNGRFNYKTGQARGAPVCVNLRTYPVKVEAGSVFIGLS