Protein Info for SM_b20761 in Sinorhizobium meliloti 1021

Annotation: carbon-phosphorus lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05861: PhnI
  • amino acids 1 to 351 (351 residues), 537.9 bits, E=4.3e-166

Best Hits

Swiss-Prot: 100% identical to PHNI_RHIME: Alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnI (phnI) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K06164, PhnI protein (inferred from 100% identity to sme:SM_b20761)

MetaCyc: 100% identical to alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase subunit PhnI (Sinorhizobium meliloti 1021)
RXN-17957 [EC: 2.7.8.37]

Predicted SEED Role

"PhnI protein" in subsystem Alkylphosphonate utilization

MetaCyc Pathways

• glyphosate degradation III (7/7 steps found)
• methylphosphonate degradation I (2/5 steps found)
• (aminomethyl)phosphonate degradation (4/8 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.37

Sequence Analysis Tools

See Q52986 at UniProt or InterPro

Protein Sequence (368 amino acids)

>SM_b20761 carbon-phosphorus lyase (Sinorhizobium meliloti 1021)
MYVAVKGGEAAIANAHRLLADRRRGDRALPAITIDQVVEQLGLAVDRVMAEASLYDRALA
ALAVRQARGDMIEAIFILRAYRTTLPRFGYCEPVDTAKMKVERRVSATYKDLPGGQLLGP
TFDYTHRLLDPSLIGEEPVDEPVLKEPGEHVMRVSDILDGEGLIEGDGKMPEGHVAGDLT
REPMEFPMARDLRLQALARGDEGFLLALAYSTQRGYGRTHPFVGEVRIGEVEVELELPEL
GFAVSLGVIRVTECQMVNQFKGSSRQPPQFTRGYGLVFGQSERKAMSMSLVDRALRTDEF
DEDIVAPAQDQEFVISHADNVQATGFVEHLKLPHYVDFQAELDLVRRMRREHDAAQAGGK
DGMKEAAE