Protein Info for SM_b20753 in Sinorhizobium meliloti 1021

Annotation: acyl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 PF02771: Acyl-CoA_dh_N" amino acids 6 to 116 (111 residues), 115.6 bits, see alignment E=3.1e-37 PF02770: Acyl-CoA_dh_M" amino acids 122 to 215 (94 residues), 89.3 bits, see alignment E=3.1e-29 PF00441: Acyl-CoA_dh_1" amino acids 227 to 376 (150 residues), 167.3 bits, see alignment E=5.5e-53 PF08028: Acyl-CoA_dh_2" amino acids 242 to 365 (124 residues), 75.6 bits, see alignment E=8.9e-25

Best Hits

Swiss-Prot: 56% identical to ACAD8_BOVIN: Isobutyryl-CoA dehydrogenase, mitochondrial (ACAD8) from Bos taurus

KEGG orthology group: None (inferred from 99% identity to smk:Sinme_4289)

MetaCyc: 44% identical to short-chain acyl-CoA dehydrogenase monomer (Pseudomonas putida KT2440)
RXN-13449 [EC: 1.3.8.1]

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.8.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92TQ5 at UniProt or InterPro

Protein Sequence (380 amino acids)

>SM_b20753 acyl-CoA dehydrogenase (Sinorhizobium meliloti 1021)
MDFRLSEEQEAIRTMALDFARDEIAPHAVDWDQQKHFPVETLRAAAALGMAGIYIRDDVG
GTGLTRLDAAMIIEALATGCPAIASFVSIHNMCAGMIDRYGTDEQRRRLLPPLLTMDVLA
SYCLTEPGSGSDAAALKTRAVREGDAYLLTGQKQFISGAGESGLYIVMARTGEEGPKGIS
AFVVEKDAPGLTFGANEKKMGWHAQPTRAVMLDNVRVSVENRLGAEGEGFRIAMAGLDGG
RLSIAAASLGGAQSAFDKALAYVQERRAFGKAIGEFQALQFRLADMATDLEIARTFLWRA
ACALDAADPEATKLCAMAKRFVTDRCFSVANDALQLHGGYGYLADYGVEKIVRDLRVHQI
LEGTNEIMRLIVSRAIMGRK