Protein Info for SM_b20750 in Sinorhizobium meliloti 1021

Annotation: dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 PF00106: adh_short" amino acids 7 to 197 (191 residues), 144.8 bits, see alignment E=3.5e-46 PF08659: KR" amino acids 10 to 167 (158 residues), 41.5 bits, see alignment E=2.1e-14 PF13561: adh_short_C2" amino acids 16 to 246 (231 residues), 175 bits, see alignment E=3.1e-55

Best Hits

Swiss-Prot: 39% identical to GNO_GLUOX: Gluconate 5-dehydrogenase (gno) from Gluconobacter oxydans (strain 621H)

KEGG orthology group: K00046, gluconate 5-dehydrogenase [EC: 1.1.1.69] (inferred from 100% identity to smk:Sinme_4292)

MetaCyc: 39% identical to D-gluconate 5-dehydrogenase monomer (Gluconobacter oxydans 621H)
1.1.1.-

Predicted SEED Role

"5-keto-D-gluconate 5-reductase (EC 1.1.1.69)" in subsystem D-gluconate and ketogluconates metabolism (EC 1.1.1.69)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.69

Use Curated BLAST to search for 1.1.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92TQ8 at UniProt or InterPro

Protein Sequence (249 amino acids)

>SM_b20750 dehydrogenase (Sinorhizobium meliloti 1021)
MFDLSGKAALVTGGGRGLGLEMAKALAGAGAWTVINGRNGQGLEEARKRLKGDGIEIGIA
AGDITRDAPAIIAAAVEKTGGLDILIHAVGERDRRGTEAMEPHEFAALLNTDLTAAYAVA
KTALPYLRRSAAGRLIFVTSIAAFAARAGDPAYTAAKGGLAALTRSLAVELGADNLTVNA
IAPGWFATETNAHLAADPALKAFVDIRIPLKRWGRPEEIAPAAVFLASPAASFVNGITLT
VDGGMTVQM