Protein Info for SM_b20721 in Sinorhizobium meliloti 1021

Annotation: two-component sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details transmembrane" amino acids 174 to 196 (23 residues), see Phobius details PF08521: 2CSK_N" amino acids 27 to 169 (143 residues), 140.6 bits, see alignment E=7.8e-45 PF26769: HAMP_PhoQ" amino acids 196 to 240 (45 residues), 39.3 bits, see alignment 1e-13 PF00512: HisKA" amino acids 246 to 309 (64 residues), 39.3 bits, see alignment E=1.1e-13 PF02518: HATPase_c" amino acids 361 to 463 (103 residues), 75.2 bits, see alignment E=1.1e-24

Best Hits

KEGG orthology group: K07649, two-component system, OmpR family, sensor histidine kinase TctE [EC: 2.7.13.3] (inferred from 100% identity to sme:SM_b20721)

Predicted SEED Role

"Tricarboxylate transport sensor protein TctE"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92TS1 at UniProt or InterPro

Protein Sequence (465 amino acids)

>SM_b20721 two-component sensor histidine kinase (Sinorhizobium meliloti 1021)
MKAVPGMRKVVYSLRRRLLGWLLISTAVIGVVALADTYREAIKTANAVSDRVLAGSALAI
AERVVVAEDGSLQVDIPYVALEMLTSAAQDRVFYRVDGPPGEFITGYQTLPSLSESTGQW
TSFADAVFRGEPIRVAALRRSASTGVNSVPFVVTVAETTIARRQLAQTIIIRSALRLGLM
IAGAAMIVWVAVTFSLRPLYRLGDAIAERSPDDLHPIREQVPNEVQGLVDTVNSFMVRLQ
SALDALRHFTGNASHQLRTPLAIIRTQLALAQRATTIEETRAAAMKADEAVANAERILAQ
LLLMAKIDAAGRDEARGLERVELGGLARAVTADHVPAAGEAGIDLGFAGEGEHWIRAEPL
LVGELLKNLIGNALLYAGRGAEVTVRVESRDHSVLLEVEDNGPGIPPELREAALKRFRRG
GEEAPGTGLGLPIVEEIAALYGGTMRLEEGDGGRGLKVVASFPAG