Protein Info for SM_b20716 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 transmembrane" amino acids 16 to 38 (23 residues), see Phobius details amino acids 46 to 68 (23 residues), see Phobius details amino acids 80 to 98 (19 residues), see Phobius details amino acids 104 to 123 (20 residues), see Phobius details amino acids 135 to 154 (20 residues), see Phobius details amino acids 160 to 179 (20 residues), see Phobius details amino acids 192 to 213 (22 residues), see Phobius details amino acids 219 to 242 (24 residues), see Phobius details amino acids 251 to 271 (21 residues), see Phobius details amino acids 277 to 295 (19 residues), see Phobius details PF00892: EamA" amino acids 18 to 149 (132 residues), 60.1 bits, see alignment E=1.5e-20 amino acids 161 to 296 (136 residues), 51 bits, see alignment E=9.7e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_4311)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92TS5 at UniProt or InterPro

Protein Sequence (298 amino acids)

>SM_b20716 hypothetical protein (Sinorhizobium meliloti 1021)
MTHQPISLSAPRHHRLLWPMMATLLVVGWSSGFVGIRYASEEAGVMLVLFWRTLLSGVIL
LPFALTIGPLLRMRGIAEQMLFGVMSVFLYLGGFALAIEQRVPTGLVALISDLLPLAIAA
LSQPVLGERLSARQWFGTAIAVFGVLIVSFDSLSFGAAPLWAYGLTVGSMLVFALASVLH
KRRRTQHMPVHQSLCIHTLTGSVLFGLCAMMQGDLAPPLTRAFAVGMVWLVLIATFAAYS
IYYTSLRLFPVAQVSAAIYLSPPVTMLWAWALFSEPLTAATFIGLTATLVGVWMTSRS