Protein Info for SM_b20713 in Sinorhizobium meliloti 1021

Annotation: sugar uptake ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 513 PF00005: ABC_tran" amino acids 39 to 189 (151 residues), 109.7 bits, see alignment E=2.6e-35 amino acids 289 to 443 (155 residues), 79.6 bits, see alignment E=5.3e-26

Best Hits

Swiss-Prot: 100% identical to RGMG2_RHIME: Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 (RB1420) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 100% identity to sme:SM_b20713)

MetaCyc: 51% identical to D-galactose/methyl-galactoside ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-18-RXN; TRANS-RXN0-541

Predicted SEED Role

"Inositol transport system ATP-binding protein" in subsystem Inositol catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92TS8 at UniProt or InterPro

Protein Sequence (513 amino acids)

>SM_b20713 sugar uptake ABC transporter ATP-binding protein (Sinorhizobium meliloti 1021)
MTLSPTTMAAVRASGAVPKSEYLLTAEGVRKEFPGVVALDDVEFKLKRGTVHALMGENGA
GKSTLMKILAGIYYPDQGEVKLRGAGIRLKSPLDALENGIAMIHQELNLMPFMTVAENIW
IRREPKNRFGFVDHGEMRRMTAKLFERLKIDLDPEIEVRHLSVANRQMVEIAKAVSYESD
VLIMDEPTSALTEREVAHLFEIIRDLRSQGIGIVYITHKMNELFEIADEFSVFRDGKYIG
THLSNEVTRDDIIRMMVGREITQMFPKEEVPIGDVVLSVKNLTLNGVFRDVSFDVRAGEI
LGVAGLVGSGRSNVAETLFGVTPASSGTIAIDGKEVVIDSANKAIRHRMAFLTEDRKDTG
CLLILDILENMQIAVLQDKFVKRGFVSEREVTAACEEMSRKLRVKTPNLQERVENLSGGN
QQKVLIGRWLLTNPRILILDEPTRGIDVGAKAEIHRLVTELARNGVAVIMISSEMPEVLG
MSDRIMVMHEGRVTGILDRAEATQIKVMELAAR